occasionally - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Occasionally: 5,130 results found.

tsplace.com T's Place! The Place for Plastic Canvas Patterns
Site devoted to Plastic Canvas and occasionally Cross Stitch. Free Projects, links to other free sites, refreshed frequently
Tsplace.com  ~   Site Info   Whois   Trace Route   RBL Check  
valonso.com Victor Alonso - Architectural - Home Builder Resources / ColdFusion Application Developer / Website Hosting - Home Page
ColdFusion Developer, Architectural Plans, Custom Homes, all under 1 roof. Located in North Houston.
Valonso.com  ~   Site Info   Whois   Trace Route   RBL Check  
waterboundkooikers.com Waterbound Kooikerhondje - Home
Welcome to Waterbound Kooikerhondje home of the versatile dutch decoy dogs. AKC and UKC Puppies occasionally. Kooiker breeder.
Waterboundkooikers.com  ~   Site Info   Whois   Trace Route   RBL Check  
aaronjohnwaltke.com QUESTIONABLE RUMINATIONS:
The Blog of Aaron J. Waltke, Professional Film Person.
Aaronjohnwaltke.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: aaronjwaltke.com - aaronwaltke.com
arizonadd.com Desert Dancer Hunting
Offering guided mearns quail hunts in Arizona. Offering Deutsch Drahthaar puppies for sale.
Arizonadd.com  ~   Site Info   Whois   Trace Route   RBL Check  
creekviewfarmenglishshepherds.com Creekview Farm English Shepherds
Our goal is to preserve the breed help others to experience a really good dog. We have puppies occasionally from our English Shepherds. We are located in SW Ohio.
Creekviewfarmenglishshepherds.com  ~   Site Info   Whois   Trace Route   RBL Check  
drricardo.net Arlene E. Ricardo, M.D. - Surgical Diseases of the Breast
Surgical Diseases of the Breast is located adjacent to the campus of Memorial Hermann Southwest Hospital and works closely with a multidisciplinary team of physicians for complete breast cancer diagnosis and treatment.
Drricardo.net  ~   Site Info   Whois   Trace Route   RBL Check  
etudesomalis.com Etude Somalis and Abyssinians
Etude Somalis is located in the San Francisco Bay Area, specializing in ruddy and silver somalis. We occasionally have litters with Abyssinian kittens. Our kittens are registered with CFA and TICA.
Etudesomalis.com  ~   Site Info   Whois   Trace Route   RBL Check  
fat-cat.net Fat Cat - Building and Travelling
naval engineering, catamaran building
Fat-cat.net  ~   Site Info   Whois   Trace Route   RBL Check  
greeneconstructionsolutions.com Services
Main page for Vent Masters Inc.
Greeneconstructionsolutions.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 51/330« Previous4950515253Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com