pakistan - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Pakistan: 35,071 results found.

helphuman.org Human Emergency Lead Programme Pakistan
helphuman counter programme human emergency lead pakistan mod vvisit joomla visitors vinaora templates joomlashine com forgot facebook world habitat password username player free bbc flash september april create share account adobe gnu august gpl license extensions challenge united youth twitter
Helphuman.org  ~   Site Info   Whois   Trace Route   RBL Check  
pakistankakhudahafiz.com Pakistan Ka Khuda Hafiz
com pakistankakhudahafiz pakistan hafiz khuda india all view posts army pakistani this news read entry rest comments real afghanistan war pkkh politics article cia usa pak taliban terror indian states delhi intelligence comment brasstacks agencies was from not taleban april
Pakistankakhudahafiz.com  ~   Site Info   Whois   Trace Route   RBL Check  
wowfaisalabad.com Faisalabad, Punjab, Pakistan, wowcities.com
wowfaisalabad sign help popup close faisalabad pakistan punjab wowcities com page portal loading wow new add group settings cities categoryedit tab layoutedit widget groupedit categorydelete description pages icondelete privilegesadd albummanage organize album connect keyworddelete share hover shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish network time
Wowfaisalabad.com  ~   Site Info   Whois   Trace Route   RBL Check  
wowgujranwala.com Gujranwala, Punjab, Pakistan, wowcities.com
wowgujranwala sign help popup close gujranwala pakistan punjab wowcities com page portal loading wow new add group settings cities categoryedit tab layoutedit widget groupedit categorydelete description pages icondelete privilegesadd albummanage organize album connect keyworddelete share hover shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish network time
Wowgujranwala.com  ~   Site Info   Whois   Trace Route   RBL Check  
wowrawalpindi.com Rawalpindi, Punjab, Pakistan, wowcities.com
wowrawalpindi sign help popup close rawalpindi pakistan punjab wowcities com page portal loading wow new add group settings cities categoryedit tab layoutedit widget groupedit categorydelete description pages icondelete privilegesadd albummanage organize album connect keyworddelete share hover shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish network time
Wowrawalpindi.com  ~   Site Info   Whois   Trace Route   RBL Check  
babagee.com ...::::BABA GEE INDUSTRIES Lahore Pakistan ::::.....
babagee baba gee industries pakistan lahore wafer range company needs valves check manufacture valve tar stop tri materials confident extensive rights reserved info com capability copyright© powered ethonsweb tpms years consistently ability understand grown industry supply process meet customer specialization
Babagee.com  ~   Site Info   Whois   Trace Route   RBL Check  
cpbep.org Canada Pakistan Basic Education Project
cpbep education basic pakistan canada project gender model forum development teacher quiz mentoring launching planning super workshop faculty district multan quality aims learning environment responsive till approval functional independent dusk virtual second performance validation evaluation report deper annual revised deliberation
Cpbep.org  ~   Site Info   Whois   Trace Route   RBL Check  
fellows.org.pk Welcome To Pakistan Fellows Welfare Organization
fellows organization welfare pakistan welcome projects fopen home function media downloads trainings careers corner pakistanwebhost com contact donation pfwo make publications high school govt charsadda relief flood goods district distributed trucks affectees provided web rohtas health mini villages renewable shall
Fellows.org.pk  ~   Site Info   Whois   Trace Route   RBL Check  
cgcpak.com Creative Group of Consultants - Islamabad. Pakistan
cgcpak services management teladel profile consultants pakistan creative group islamabad range financial social institutions experts interventions improve efficiency productivity organizations privacy situations particular website implement statement cost effectiveness banks analyse education sector private government bank providing undp akdn world public
Cgcpak.com  ~   Site Info   Whois   Trace Route   RBL Check  
dilpasand.com Industrial Gloves Manufacturer Pakistan-PVC Gloves-Wholesale Gloves-Leather Working Gloves-Nylon Gloves-Jersey Gloves-Safety Gloves From Dilpasand Hosiery Faisalabad
dilpasand gloves enlarge pakistan industrial manufacturer pvc jersey nylon knitted dipped working latex seamless safety hosiery coated wholesale leather interlock seo faisalabad nitrile cotton wrist gram terry dotted drill quality contact different home profile polyester fibre mix cuff weight mitten
Dilpasand.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 495/631« Previous493494495496497Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com