parkway - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Parkway: 21,845 results found.

parkwaycampusenhancement.org Parkway Christian Church and Schools - Home - Journey With Us
Welcome to Parkway Christian Church and Schools! With so many other things out here on the web…and with so much else going on in your life, thanks for stopping by and checking out our Campus Enhancement Program.
Parkwaycampusenhancement.org  ~   Site Info   Whois   Trace Route   RBL Check  
parkwaycleaners.com | Parkway Cleaners| Selected as one of America's Best Cleaners
Parkway Cleaners offers professional shirt service, custom dry cleaning, alterations & repairs, household care, wedding gown preservation and leather cleaning.
Parkwaycleaners.com  ~   Site Info   Whois   Trace Route   RBL Check  
parkwaymotel.com Parkway Motel in Wawa: Clean/Quiet place to relax
Parkway Motel in Wawa: fully renovated Motel; clean and quiet units. Smoke free; some rooms pet friendly
Parkwaymotel.com  ~   Site Info   Whois   Trace Route   RBL Check  
santaclarariverparkway.org Home — Santa Clara River Parkway
The Santa Clara River Parkway is a project of the California State Coastal Conservancy, in collaboration with The Nature Conservancy, other local non-profit organizations, floodplain landowners, and local governments. The goal of the Parkway is the acquisition and restoration of floodplain lands within the lower Santa Clara River corridor.
Santaclarariverparkway.org  ~   Site Info   Whois   Trace Route   RBL Check  
parkwayfellowship.org Parkway Fellowship / Welcome! / Welcome!
Parkway Fellowship is an evangelical congregation. We take God at His Word in that we believe everything in the Bible is true. We preach the crucified and resurrected LORD Jesus Christ as the sole answer to all of mankind's problems.
Parkwayfellowship.org  ~   Site Info   Whois   Trace Route   RBL Check  
parkwayvillagemhc.com Parkway Village Manufactured Home Community in Jackson, TN
Parkway Village Mobile Home & RV Community in Jackson, Tennessee (TN) - homes for sale, monthly rent, incentives, and other information.
Parkwayvillagemhc.com  ~   Site Info   Whois   Trace Route   RBL Check  
humpbackrocks.com Humpback Rocks - Blue Ridge Parkway
Pictures of Humpback Rocks on the Blue Ridge Parkway, courtesy of Waynesboro.Com.
Humpbackrocks.com  ~   Site Info   Whois   Trace Route   RBL Check  
jproctordds.com James Proctor, DDS, PC | Children's Dentistry of Conyers | 770-483-6800
Dr. Proctor has been practicing Pediatric Dentistry for over 15 years in Conyers, Georgia. Make an appointment today 770-483-6800.
Jproctordds.com  ~   Site Info   Whois   Trace Route   RBL Check  
parkwaypowerhouse.com Parkway Honda | Honda Dealer in Toronto, ON - New and Used
Official Website of Parkway Honda : New and used car dealer in Honda. Choose Toronto, ON for purchase, lease, parts.
Parkwaypowerhouse.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: poweredbyparkway.com
hyattplacememphisprimacyparkway.com Memphis Hotel - Primacy Parkway Hotel | Hyatt Place
The Hyatt Place Memphis/Primacy Parkway hotel on Primacy Parkway has free Wi-Fi & a complimentary continental breakfast. There's a 42" HDTV in every room & the hotel is entirely smoke free.
Hyattplacememphisprimacyparkway.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 41/632« Previous3940414243Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com