pey - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Pey: 228 results found.

pirkanmaanepilepsiayhdistys.info Pirkanmaan Epilepsiayhdistys ry - Etusivu
Pirkanmaan Epilepsiayhdistys ry:n verkkojulkaisu
Pirkanmaanepilepsiayhdistys.info  ~   Site Info   Whois   Trace Route   RBL Check  
saint-christoly.com Centre Commercial Saint-Christoly - Bordeaux
Le Centre Commercial Saint-Christoly en centre ville de Bordeaux, sa galerie et ses magasins sont à votre service et vous accueillent tout au long de l'année.
Saint-christoly.com  ~   Site Info   Whois   Trace Route   RBL Check  
wauhaha.com Wauhaha!
Wauhaha,Incunifies the world strong development technology, the Malaysian native place culture characteristic and the Internet development present situation, develops the Malaysian Internet software infrastructure technology platform with all one's strength, provides the individual to be able to display the heart dream since childhood... , is also your Internet enterprise essential partner.
Wauhaha.com  ~   Site Info   Whois   Trace Route   RBL Check  
oilandmoney.com Oil & Money 2011
Oil & Money conference annually gathers the most significant senior executives from the petroleum and natural gas industry across the globe. This year's conference will be held at the InterContinental London Park Lane on October 11 and 12.
Oilandmoney.com  ~   Site Info   Whois   Trace Route   RBL Check  
qi-motion.com Qi-Motion
*Qi-Motion*. Praktijk voor Acupunctuur, Qigong en Mindfulness in Pey - Echt, Limburg, Nederland
Qi-motion.com  ~   Site Info   Whois   Trace Route   RBL Check  
lacooperativemontolieu.com MONTOLIEU | La coopérative Centre d'Art et de Littérature
Le site officiel du Centre d'Art et de Littérature La coopérative, Montolieu, village du livre, France
Lacooperativemontolieu.com  ~   Site Info   Whois   Trace Route   RBL Check  
incidences.info incidences Marseille
INCIDENCES, DVD edition, art et poesie litterature, création vidéo, videopoetry, poesie experimentale, net art, edition indépendante, label d'artistes,
Incidences.info  ~   Site Info   Whois   Trace Route   RBL Check  
lacavedourthe.com Grands crus Bordeaux, grands crus Margaux, grands crus Saint Emilion, vins Dourthe, champagne millésimé : achat et vente de vins sur Internet - La cave Dourthe
La cave Dourthe, des grands crus Margaux, grands crus Saint Emilion et champagnes millésimés. Notre sélection : Argentine, Barsac, Cérons, Pessac Léognan, Pauillac, Pomerol, Saint Estèphe et Sauternes.
Lacavedourthe.com  ~   Site Info   Whois   Trace Route   RBL Check  
kairos-immobilier.com Immobilier bordeaux kairos immobilier 33
Agence Charmes du Sud
Kairos-immobilier.com  ~   Site Info   Whois   Trace Route   RBL Check  
peymelec.com Vente électroménager, installation, Peymeinade, Alpes-Maritimes (06)
Bienvenue sur le site de Pey Melec, spécialiste de la vente et de l'installation d'électroménagers et de cuisines à Peymeinade dans les Alpes Maritimes (06). Nous vous proposons de nombreuses marques de l'électroménager, dont des réfrigérateurs, machines à laver, micro-ondes, cafetières, aspirateurs. Mais aussi des climatisations, ainsi que tous les appareils indispensables pour votre salle de bain.
Peymelec.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 3/15« Previous12345Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com