pradeshjammu - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Pradeshjammu: 94 results found.

ibuzzmobile.com iBUZZ
ibuzzmobile ibuzz site ignitee career map faqs know player flash adobe friend tell partners careers services contact caring product home ist november rights best reserved designed handsets developed copyright disclaimer kashmirjharkhandkarnatakakeralamadhya pradeshmaharashtrameghalayamumbaiorissapunjabrajasthanromtamil naduuttar pradeshjammu pradeshassambiharchhatisgarhdelhigoagujaratharyanahimachal select state ambikapurandhra pradeshuttaranchalwest bengal
Ibuzzmobile.com  ~   Site Info   Whois   Trace Route   RBL Check  
hotelsandresorts.co.in Hotels and Resorts Search Engine India
hotelsandresorts tracker godaddy hotels india resorts search engine star kashmirjharkhandkarnatakakeralalakshadweepmadhya pradeshjammu diudelhigoagujaratharyanahimachal pradeshmaharashtramanipurmeghalayamizoramnagalandorissapondicherrypunjabrajasthansikkimtamil list luxury havelidaman bengal pradeshuttaranchalwest nadutripurauttar islandsandhra hotel type town city home economy hotelspalace pradesharunachal pradeshassambiharchandigarhchhattisgarhdadra nicobar andaman hotelsresorts nagar
Hotelsandresorts.co.in  ~   Site Info   Whois   Trace Route   RBL Check  
sms4k.com SMS4K: Send Free text message to any mobile in INDIA
sms4k sms working password terms privacy forgot mobile free text send message india pradeshjammu diudelhigoagujaratharyanahimachal kashmirjharkhandkarnatakakeralalakshadweepmadhya pradeshassambiharchandigarhchhattisgarhdadra nagar havelidaman conditions agree pradesharunachal bengal pradeshuttarakhandwest nadutripurauttar pradeshmaharashtramanipurmeghalayamizoramnagalandorissapuducherrypunjabrajasthansikkimtamil year user signup email new recovery updated xforgot gender selectmale select stateandaman state monthjanfebmaraprmayjunjulaugsepoctnovdec
Sms4k.com  ~   Site Info   Whois   Trace Route   RBL Check  
bloodindia.com Blood India - Donate Your Blood And Make Difference
bloodindia ondline infotech blood india donate difference make register password group donor compatibilitytips city pradeshuttaranchalwest donation bengal district copyright reserved project right nadutripurauttar services testimonial speak havelidaman forgot username state user member home login registered select andaman diudelhigoagujratharyanahimachal pradeshjammu kashmirjharkhandkarnatakakeralalakshadweepmadhya
Bloodindia.com  ~   Site Info   Whois   Trace Route   RBL Check  
ebharatbase.com B2B Business Directory,Companies Directory,India
ebharatbase home directory companies business india new required field password request create account user mail pradesh search browse pradesharunachal navigation pradeshjammu skip bengal news schools real ebharat useful pondicherry listing andaman advertise terms policy base vinayras infotech products use add
Ebharatbase.com  ~   Site Info   Whois   Trace Route   RBL Check  
ttmi2.com Welcome to TTMI
west bengal travel agent, west bengal hotels, kolkata travel agent, kolkata tour operator, kolkata hotels, west bengal tour operator, kolkata hotels, west bengal tour operator, kolkata car rental, west bengal package tour, kolkata package tour, west bengal tourism, west bengal tourism hotels
Ttmi2.com  ~   Site Info   Whois   Trace Route   RBL Check  
cybercafeindia.com Cyber Cafe India
cybercafeindia cafe cyber india list click details locations pradesh home internet contact cafes bihar new ascent friends komal bengal policy privacy nagar andaman orissa rajkot directory tatva pradesharunachal nadutripurauttar following states pradeshassambiharbiharbiharchandigarhchhattisgarhdadra nicobarandhra powered added pradeshjammu recently pradeshmaharashtramanipurmeghalayamizoramnagalandorissaorissapondicherrypunjabrajasthanrajkotrajkotsikkimtamil pradeshuttaranchalwest diudelhigoagujaratharyanahimachal
Cybercafeindia.com  ~   Site Info   Whois   Trace Route   RBL Check  
theexploreholidays.com :: Welcome to The-Explore Holidays ::
theexploreholidays kerala holidays explore welcome india pradesh packages rajasthan national tamilnadu island tour himachal north east summer west honeymoon parkremember rajasthanranthambhore jaipurgoagujaratmaharashtrahoneymoon tourssummer trianglehistorical rajasthantrip pradesharunachal islandandhra pradeshuttrakhandandaman bengalgolden pradeshjammu pradeshkarnatakakeralalakshadweep kashmirpunjabuttar islandtamilnadutamilnadu keralabiharchhattisgarhmadhya pradeshassammanipurmeghalayamizoramnagalandsikkimtripuraorissawest country god andhra bihar karnataka
Theexploreholidays.com  ~   Site Info   Whois   Trace Route   RBL Check  
donorex.com DonorEx | Registration Form
donorex registration form hospitals home unsubscribe privacy disclosure policy area blood email diudelhigoagujaratharyanahimachal havelidaman pradeshjammu nagar pradeshassambiharchandigarhchhattisgarhdadra city district pradesharunachal pradeshuttarakhandwest nadutripurauttar pradeshmaharashtramanipurmeghalayamizoramnagalandorissapuducherrypunjabrajasthansikkimtamil kashmirjharkhandkarnatakakeralalakshadweepmadhya bengal mobile donor islandsandhra state nicobar andaman years age affirm registering sms provided medically legally donate
Donorex.com  ~   Site Info   Whois   Trace Route   RBL Check  
selectyourvehicle.com :: Select Your Vehicle ::
selectyourvehicle vehicle select counter hit sell vehicles helpline contact link accessories useful home wanted buy manufactures tips designs otwo wheelers thousands fast trade delhinoidapatnapuneranchishimlasrinagarthiruvananthapuramvaranasivishakapatnam ahmedabadbangalorebhopalbhubaneshwarchandigarhchennaicoimbatoreernakulamgurgaonguwahatihyderabadjaipurjamshedpurkolkatakozhikodelucknowmeerutmumbainew powerd reserved right |sell north nicobarandhra pradeshassam andaman selectstate used type eastbiharchandigarhchattisgarhdelhigoagujaratharyanahimachal pradeshjammu pradeshuttaranchalwest bengal
Selectyourvehicle.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 4/6« Previous23456Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com