raccoons - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Raccoons: 1,757 results found.

allcreatureswildlife.com   Pest Control Services - Lakeland, FL - All Creatures Wildlife Control
All Creatures Wildlife Control offers pest control services in Lakeland, FL.
Allcreatureswildlife.com  ~   Site Info   Whois   Trace Route   RBL Check  
animaldamage.com Raccoon and Animal Damage Restoration - Aumillers Inc
Aumillers Inc. specializes in raccoon and animal damage repair services and insuranace restoration repair services
Animaldamage.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: raccoondamage.com
annapolisanimalcontrol.org Animal Control Annapolis Bat Attic Removal Raccoon Squirrel
Animal Control Annapolis Bat Removal Guaranteed Raccoon Bird Bat Squirrel Removal and control bird and wildlife removal animal control trapping raccoon and squirrel
Annapolisanimalcontrol.org  ~   Site Info   Whois   Trace Route   RBL Check  
chimneyandwildlifespecialist.com Dallas Chimney Sweep - DFW Cleaning - Home
Dallas Chimney and Wildlife Specialist offers chimney sweep service, chimney cleaning, chimney caps and wildlife attic removal in Dallas and DFW, including skunks and raccoons.
Chimneyandwildlifespecialist.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: dallaschimneywildlife.com
raskbb.com Bulletin Boards
Bulletin board of interest. Information on Harley, Triumph and BSA motorcycles. Bulletin board on exotic animals.
Raskbb.com  ~   Site Info   Whois   Trace Route   RBL Check  
affordableanimalcontrolmi.com Animal Control Temperance, MI
Affordable Property Maintenance & Animal Control provides nuisance animal removal and beekeeper service to Temperance,MI.Call 419-367-6922 for inquiries.
Affordableanimalcontrolmi.com  ~   Site Info   Whois   Trace Route   RBL Check  
allamericanwildlife.com All American Wildlife Control
wildlife control, Joe Harkreader, squirrels, skunks, raccoons, birds, bats, pigeons, property managers, homeowners, nuisance wildlife, trapping, removal, Denver, Colorado, Parker
Allamericanwildlife.com  ~   Site Info   Whois   Trace Route   RBL Check  
animalremoval.net Animal Removal Specialist
Live Animal Removal – Safe, Humane Trapping – 877-227-2596 – Los Angeles, Ventura, Santa Barbara
Animalremoval.net  ~   Site Info   Whois   Trace Route   RBL Check  
kaysmithphotos.com Kay Smith Photography
Photography of Northern Michigan, Landscapes, Wildlife, Lighthouses, Flowers, Domestic Flowers, Wildflowers, Portraits, Rivers, Boats, Insects, Dragonflies, Birds, Raccoons, Still Lifes, Panoramas
Kaysmithphotos.com  ~   Site Info   Whois   Trace Route   RBL Check  
pestcontrolfl.com Pest Control Specialists Inc of Broward and South Palm Beach
Pest Control Specialists is a full service pest management company serving all of Broward and South Palm Beach Counties. Providing service to Residential or Commercial customers. Pest Control Specialists guarantees on any service performed on Termites and Fumigation, Lawn Care, Ornamental Plants and Trees, Bugs, Cockroaches, Fleas, Ants, Mosquito Reduction, Red Ants and Termites. Pest Control also provides Specialized Services for small animals like, Raccoons, Opossums, rats, Iquanas and snakes.
Pestcontrolfl.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: pestcontrolspecialistsfl.com
 


Page 50/90« Previous4849505152Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com