rci - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Rci: 2,870 results found.

anfisalesuk.com Buy Timeshares - Sell Timeshare - Worldwide Timeshare Hypermarket
Worldwide Timeshare Hypermarket is the place to go if you are thinking of buying or selling a timeshare.We sell all the top resorts i.e. Anfi Beach Club, Marriotts,Devere Group and Club la Costa and Seasons PLC to name a few. If you are thinking of either buying or selling a timeshare then call Worldwide Timeshare Hypermarket first. See us on National and Sky Television as well as in all the major newspapers.Worldwide Timeshare Hypermarket will always get you the best deal.Members of RDO & TATOC
Anfisalesuk.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: anfitimeshare.com - buy-anfi.com - buyanfi.com - macdonaldtimeshareresales.com - seasonsplctimeshareresales.com - timeshare-hypermarket.com - timeshare-uk.co.uk - visionsoftheworldtimeshareresales.com - world-widepoints.com - world-widepoints.net - worldwidepoints.net - worldwidetimeshare-hypermarket.com - worldwidetimesharehypermarket.com - worldwidetimesharehypermarket.net - worldwidetimesharehypermarket.org - wwth.net
cbrci.com Bozeman Real Estate - Homes for Sale in Montana - Coldwell Banker, Bozeman, MT
Search for Bozeman Real Estate. Coldwell Banker RCI Realty in Bozeman, MT can assist you with every home for sale and real estate property for sale in the Bozeman, Montana area.
Cbrci.com  ~   Site Info   Whois   Trace Route   RBL Check  
letsgocanaries.co.uk Lets Go Canaries - Holidays Tenerife, Gran Canaria, Fuerteventura, Lanzarote
Lets go canaries, for holidays and rci affiliated rentals of villas and apartments in the canary islands tenerife, fuerteventura, gran canaria and lanzarote.
Letsgocanaries.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
rovingcoach.com Employee Coaching Company | On-Site Coaching Solutions « Roving Coach
Roving Coach is an Employee Engagement company offering on-site and remote coaching as a great place to work benefit in focused 30-minute sessions to
Rovingcoach.com  ~   Site Info   Whois   Trace Route   RBL Check  
countryvacationsamruthacastle.com Country Vacations India | Country Vacations Amruthacastle
Country Vacations India offers the best luxury hotel - Amrutha Castle designed in European style for business and the family fun right in the middle of the Hyderabad city for the guests.
Countryvacationsamruthacastle.com  ~   Site Info   Whois   Trace Route   RBL Check  
roraimaconsulting.com Home
Home
Roraimaconsulting.com  ~   Site Info   Whois   Trace Route   RBL Check  
thalermetal.com Home of Thaler Metal Industries
Thaler Metal Industries specializes in roof accessories
Thalermetal.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: thalermetalusa.com
coastal4less.com Coastal4Less
Timeshare Resales
Coastal4less.com  ~   Site Info   Whois   Trace Route   RBL Check  
markloadsystems.com Markload Systems, Load Moment Indicators - Rated Capacity Indicators - Safe Load Indicators
Markload Systems manufactures load monitoring equipment for all types of cranes.
Markloadsystems.com  ~   Site Info   Whois   Trace Route   RBL Check  
preferedchoiceproperties.com Timeshare Resales, Buy Timeshare, Sell Timeshare
Including buying or selling timeshares and browse timeshare listings from Preferred Choice Properties.
Preferedchoiceproperties.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: preferedchoiceproperty.com - preferredchoiceproperties.com - preferredchoiceproperty.com - realtyxtimeshare.com - realtyxtimeshares.com - timeshareresaleagents.com
 


Page 51/158« Previous4950515253Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com