rdo - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Rdo: 299 results found.

zimmermansautomotive.com Zimmerman's Automotive: Home
Zimmerman's Automotive - Custom Painting, RDO Construction, and Metal Fabrication
Zimmermansautomotive.com  ~   Site Info   Whois   Trace Route   RBL Check  
in-situ.com In-Situ Inc.
In-Situ Inc. is a leading manufacturer of in situ (on-site) water monitoring instruments. We provide rugged, reliable, and accurate instruments for field measurement with the best service in the industry.
In-situ.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: in-situ-inc.com - in-situaquaculture.com
anfisalesuk.com Buy Timeshares - Sell Timeshare - Worldwide Timeshare Hypermarket
Worldwide Timeshare Hypermarket is the place to go if you are thinking of buying or selling a timeshare.We sell all the top resorts i.e. Anfi Beach Club, Marriotts,Devere Group and Club la Costa and Seasons PLC to name a few. If you are thinking of either buying or selling a timeshare then call Worldwide Timeshare Hypermarket first. See us on National and Sky Television as well as in all the major newspapers.Worldwide Timeshare Hypermarket will always get you the best deal.Members of RDO & TATOC
Anfisalesuk.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: anfitimeshare.com - buy-anfi.com - buyanfi.com - macdonaldtimeshareresales.com - seasonsplctimeshareresales.com - timeshare-hypermarket.com - timeshare-uk.co.uk - visionsoftheworldtimeshareresales.com - world-widepoints.com - world-widepoints.net - worldwidepoints.net - worldwidetimeshare-hypermarket.com - worldwidetimesharehypermarket.com - worldwidetimesharehypermarket.net - worldwidetimesharehypermarket.org - wwth.net
irishgrassland.com Irish Grasslands Association (IGA) - IGA Dairy Conference 2010 - Official Website
Irish Grasslands Association (IGA) was founded in 1949 to advance and spread the knowledge of modern grassland husbandry. Annual IGA Dairy Conference 2010.
Irishgrassland.com  ~   Site Info   Whois   Trace Route   RBL Check  
shatma.ir دفتر پيشرفت وسياست گذاري دوراندیش
دفتر پيشرفت وسياست گذاري دوراندیش -
Shatma.ir  ~   Site Info   Whois   Trace Route   RBL Check  
cockerspanielclubofga.com Cocker Spaniel Specialty Club of Georgia > Home
Cocker Spaniel Specialty Club of Georgia
Cockerspanielclubofga.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: cockerspanielclubofga.org
optislang.com Home: DYNARDO GMBH
Die Dynardo GmbH ist ihr Premiumdienstleister auf dem Gebiet CAE-basierter Robustheitsbewertung, Zuverlässigkeitsanalyse und Robust Design Optimierung mit Sitz in Weimar.
Optislang.com  ~   Site Info   Whois   Trace Route   RBL Check  
bl-lynx.com custom | BAD LAND Lynx
Just another WordPress site
Bl-lynx.com  ~   Site Info   Whois   Trace Route   RBL Check  
newsinformatiche.it NewsInformatiche.it
Newsinformatiche.it è un blog che ha lo scopo di mantenere l'informazione sul mondo dell'informatica. Troverete guide e trucchi per molti programmi interessanti, e non dimenticatevi ovviamente che troverete le news dei nuovi componenti in circolazione e dei nuovi software!
Newsinformatiche.it  ~   Site Info   Whois   Trace Route   RBL Check  
bouvierclub.org Bouvier des Flandres Club of Southeastern Michigan
The Bouvier des Flandres Club of Southeastern Michigan is a non-profit organization formed to share the experiences of ownership, to encourage and promote quality in the breeding of purebred Bouvier des Flandres and to encourage good sportsmanlike competition at dog shows and obedience trials and other competitive events
Bouvierclub.org  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 9/19« Previous7891011Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com