redcar - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Redcar: 695 results found.

supplynfitcarpets.co.uk Carpets in Cleveland - Supply 'n' Fit Carpets - We bring our shop to you | Home Selection | Middlesbrough | Stockton | Darlington | Hartlepool
We pride ourselves on offering a unique customer service. We take the shop to our customer! Our Home Selection Service means we take appropriate samples to the customers home or office enabling them to select floor coverings to match or compliment existing furnishings.
Supplynfitcarpets.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
ten-chi.org Ten-Chi Karate Cleveland, Confidence from within
Ten-Chi Karate Cleveland : - SYLLABUS KATAS VENUES FAQ'S GALLERY GRADING INFO EVENTS TERMINOLOGY INSTRUCTORS EQUIPMENT INFORMATION Ten-Chi, Ten-Chi Karate, Karate Redcar, Karate Eston, Cleveland Karate School, Exsultra,Gradings
Ten-chi.org  ~   Site Info   Whois   Trace Route   RBL Check  
englishschoolofmotoring.com Driving Instructor Training, Driving Instructor Courses Middlesbrough
Driving Instructor Training, Driving Instructor Courses Middlesbrough
Englishschoolofmotoring.com  ~   Site Info   Whois   Trace Route   RBL Check  
music-link.org MUSIC:LINK Lincolnshire
The Music Information Service in Lincoln and Lincolnshire. Provides publicity through the monthly Diary and Music:Link's own BBC Radio programme. Acts as a focus for Lincolnshire's musical organisations and music-lovers.
Music-link.org  ~   Site Info   Whois   Trace Route   RBL Check  
kitchenandbedroominteriors.com Fitted kitchens middlesbrough bedrooms luxury showers wardrobes doors shops
Middlesbrough cleveland teesside harltepool billingham thornaby darlington stockton darlington fitted kitchens doors wardrobes saunas showrooms bathrooms bedrooms showers enclosures surrounds durham guisborough redcar thirsk kitchen deluxe luxury designer
Kitchenandbedroominteriors.com  ~   Site Info   Whois   Trace Route   RBL Check  
teesvalleyemergencyplanning.info Redirecting to Cleveland Emergency Planning
Information regarding the management of major incidents and disasters in the former Cleveland area
Teesvalleyemergencyplanning.info  ~   Site Info   Whois   Trace Route   RBL Check  
teesvalleystudios.com Portrait Wedding Baby Photographer Studio Stockton on Tees Norton - Home
Tees Valley Studios wedding portraits studio based Norton Stockton on Tees
Teesvalleystudios.com  ~   Site Info   Whois   Trace Route   RBL Check  
delboyvanhire.com Del Boy Van Hire Teesside - Trotter Van Teesside - Only Fools & Horses
Hire a Del Boy van for your wedding, party or event in Middlesbrough, Stockton, Billingham, Thornaby, Darlington, Redcar and throughout Teesside aand Cleveland
Delboyvanhire.com  ~   Site Info   Whois   Trace Route   RBL Check  
falconflightlink.co.uk Falcon Flightlink :: Nationwide Airport Transfers - Airport Transfers UK - Airport Taxi UK
Falcon Flightlink are a airport transfer company that specialises in providing airport taxis & airport transfers in the UK & Nationwide
Falconflightlink.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
spendlesscarrentals.com Car Rental Melbourne | Spendless Car Rentals Car Hire Bargain Wheels Car Rental Melbourne, Sydney, Tullamarine, Airport, Gold Coast
Car Hire | Independent Car Rental & National Car Hire Companies in Brisbane, Sydney, Melbourne, Adelaide, Perth, Darwin, Canberra, Hobart, Cairns, Surfers Paradise.
Spendlesscarrentals.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 15/32« Previous1314151617Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com