residental - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Residental: 3,123 results found.

koeringexcavating.com Koering Excavating, In- Vineland, New Jersey
koeringexcavating koering excavating vineland jersey new truck loader brothers dozier sign excavator family clearing owned operated snow gravel fax ~commercial box est excavation site preparation septic topsoil grading residental systems
Koeringexcavating.com  ~   Site Info   Whois   Trace Route   RBL Check  
ca-rebf.com Chavez & Associates
associates chavez rebf ca services covina lanight header theater blkline beachnight setstats cityhall dodgersta firm estate real industrial home property office people yahoo web hosting search contact residental land loopnet development commercial investment right financing owners mission brokerage buyers comprehensive
Ca-rebf.com  ~   Site Info   Whois   Trace Route   RBL Check  
newedges.com Properties For Builders
newedges builders properties builder click login nagar register home residental rent house pondicherry mylapore apartment floor hampi buy suggest future contact city post select guest document untitled ghgfhfgfdgdfgdfggfhgfhhfghghgfhbbvjyiuiuihj requirement project state sdfsf nicobar pradeshmaharashtramanipurmeghalayamizoramnagalandorissapondicherrypunjabrajasthansikkimtamilnadutripurauttar kashmirjharkhandkarnatakakeralalakshadweepmadhya pradeshuttaranchalwest bengal welcome pradeshjammu diudelhigoagujaratharyanahimachal
Newedges.com  ~   Site Info   Whois   Trace Route   RBL Check  
dynamictouchpainting.com Orlando Painting Contractor, Residential, Commercial, House Painter, Dynamic Touch Inc.”
dynamictouchpainting commercial dynamic touch painting orlando residential contractor house painter home contact gallery residental process quality complete offer interior exterior greater business service customer professional makes offered removal services estimates color repainting free sampling clients company projects wallpaper repair damage
Dynamictouchpainting.com  ~   Site Info   Whois   Trace Route   RBL Check  
jascoservices.com Jasco Services - Custom Metal Buildings, Metal Roofing, and Parking Lot Striping
jascoservices metal lot striping roofing parking buildings building jasco services custom gallery contact photo online quote home residental commercial reserved rights accepting copyrights© slab concrete fall special includes
Jascoservices.com  ~   Site Info   Whois   Trace Route   RBL Check  
luncefordgroup.com Lunceford Group Construction
luncefordgroup commercial lunceford construction group contact residential demolition home design company website rocky old ridge birmingham logo shadow residental
Luncefordgroup.com  ~   Site Info   Whois   Trace Route   RBL Check  
therealtyalliance.com The Realty Alliance
therealtyalliance realty alliance home contact flags usa canada password username forgot real realtors estate ideas connecting memers large leanding speaking residental brokerages industry homeservices america prudential royal lepage leike long company crye foster services howard william edina ruhl coldwell roach
Therealtyalliance.com  ~   Site Info   Whois   Trace Route   RBL Check  
tricountycarpets.com TRI-COUNTY CARPETS
tricountycarpets tri carpets county information contact latest links partners industrial offers special years serving com welcome central new residental york commerical
Tricountycarpets.com  ~   Site Info   Whois   Trace Route   RBL Check  
interstategreenhouse.com Interstate Greenhouse Company - A division of TGSI - Established 1988 (20th anniversary 1988-2008)
interstategreenhouse greenhouse interstate company anniversary established division tgsi projects greenhouses residental contact sitemap disclaimer site amteam completed structures new home shade used systems parts benches service good glass clear browse offerings rights reserved copyright like just installing northeastern small delivering
Interstategreenhouse.com  ~   Site Info   Whois   Trace Route   RBL Check  
lumbremetal.com Welcome to Lumbre Metal | Stainless Furniture & More
lumbremetal contact furniture stainless metal welcome lumbre commercial flooring art fine steel exhibitions residential residental applications trade
Lumbremetal.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 159/201« Previous157158159160161Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com