signup - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Signup: 129,015 results found.

myillustrationbox.com Sermon Illustrations, Sermon Tools :: Illustration Box
myillustrationbox dashboard free signup sermon illustration box illustrations tools save search store management join screenshot added illustrationbox author original content view add clicking data addition meta info useful saving great tags related appear category click type story quote source future
Myillustrationbox.com  ~   Site Info   Whois   Trace Route   RBL Check  
smtjaipattidevismarakmahavidyalaya.org Smt. Jaipatti Devi Smarak Mahavidyalaya Pargana Karchana Allahabad
smtjaipattidevismarakmahavidyalaya signup email smt mahavidyalaya devi smarak jaipatti karchana pargana allahabad contact affiliation society rights area tehsil village query infrastructure academics home members staff online established pradesh rural backward people reserved abhishek mishra uttar yogesh saran developed education website comes
Smtjaipattidevismarakmahavidyalaya.org  ~   Site Info   Whois   Trace Route   RBL Check  
my-mcc.com S-RESA Lesson Planner
signup login mcc lesson planner resa plans create mississippi time administrator minutes correlated items teaching strategies electronic test use submit instantaneously track correlations plan textbook subject including area period teacher sorted entire year electronically lessons support writing matter using intensive
My-mcc.com  ~   Site Info   Whois   Trace Route   RBL Check  
activitybrokerhawaii.com Newsletter signup
activitybrokerhawaii newsletter signup hawaii car rental required field great site know activities information service money best food privacy surfing value won share want save shopping exciting things email com fun friendly cultural sites specials children historical free excited rentals offer
Activitybrokerhawaii.com  ~   Site Info   Whois   Trace Route   RBL Check  
bethburke.com Acupuncture with Beth Burke
bethburke signup newsletter line decor acupuncture beth burke info chinese spectrum herbs center contact pharmacy com herbal manufacturing process trusted come formulas supplier certified standards highest good interested street suite silver spring cameron linksdirections learning benefit centerabout gmp provide people
Bethburke.com  ~   Site Info   Whois   Trace Route   RBL Check  
fullvin.com FullVIN.com Vehicle History Reports for Less
fullvin login signup vehicle history reports com number car run vin include friendly registered service mobile report device imagine able wanting convenient way purchase quick canadian auction dealer auto need competitors charge character detailed member welcome dollars don file enter
Fullvin.com  ~   Site Info   Whois   Trace Route   RBL Check  
addittothelist.com Add it to the list
addittothelist login signup add list dynamic smith edge password link click logged steve
Addittothelist.com  ~   Site Info   Whois   Trace Route   RBL Check  
jimmac.net DistServe: Signup
jimmac default distserve signup backup online fallback make storage help secure easy memories reliable save important life work easier close provides says needs hard striving access music silent photos videos documents locations multiple just install simple clicks stop set theora
Jimmac.net  ~   Site Info   Whois   Trace Route   RBL Check  
xwt-classics.net XWT-Classics
classics xwt signup login hide wrestlemania april wwf torrents weekend upload double deny donations superstars enjoy recieved leech credit past free great aswell celebrating gifts main site time wrestling disc prime recent uploadednameseederleechercwf latest apr august xvid wwwf news
Xwt-classics.net  ~   Site Info   Whois   Trace Route   RBL Check  
gforcekarts.com G-Force Karts: Where Every Day Is Race Day
gforcekarts signup facebook day force karts race racing experience specials corporate members event incredible iron email military member man track series great events special come buy march monthly choose promotions video watch news promos thrill offer customers years experiences kart
Gforcekarts.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 201/500« Previous199200201202203Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com