sioux - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Sioux: 11,280 results found.

stencilcorporation.com Stencil Corporation - Real Estate, Apartments, and Developments - Sioux Falls, South Dakota
stencilcorporation eservices gage falls sioux stencil corporation estate real south dakota apartments developments icon list residential commercial mail email newsletter hosted area bygage provides premiere complexes developer based mailing join apartment management property owns homes logo development lots floor plans
Stencilcorporation.com  ~   Site Info   Whois   Trace Route   RBL Check  
northernhacking.org Cheap Luxury Hotel Rooms in Sioux Falls
northernhacking hotel falls cheap sioux rooms luxury waikiki hotels airport region city rsd district country landmark aqua beach village usa new marina pearl otani kaimana cabana renton whitmore surf eugenia kahana holiday rentals aloha maunaloa condominiums international dillingham innsuites flagstaff
Northernhacking.org  ~   Site Info   Whois   Trace Route   RBL Check  
ncuro.com North Central Urology | Sioux Falls, SD
ncuro map view larger north urology central sioux falls patient urological relationship care provide outside office believe physician comfort home dakota created website extend based treatments explore south trusted resource invite conditions mutual trust tests learn experience welcome ave mission
Ncuro.com  ~   Site Info   Whois   Trace Route   RBL Check  
siouxcityrollerdames.com Sioux City Roller Dames Home
siouxcityrollerdames roller report skinner twitter sioux blog dames home city play follow info favorite ave morningside dame kinetico interleague want emailrecruiting volunteering water nice bout updates recent official results current dalton available tickets derby office
Siouxcityrollerdames.com  ~   Site Info   Whois   Trace Route   RBL Check  
justicefire.com Welcome - Justice Fire and Safety in Sioux Falls, SD
justicefire sioux falls website justice safety welcome systems drew design dakota south service lighting aid supplies photo emergency kitchen exit clean agent alarm installation extinguishers protection cabinets extinguisher photos contact home industrial vehicle gallery links site history map check businesses
Justicefire.com  ~   Site Info   Whois   Trace Route   RBL Check  
siouxempiremlh.org Sioux Empire Mended Little Hearts
mended little hearts,heart defects, heart disease,Sioux empire,transposition of the greater arteries,ventricular septal defect,congenital heart disease,shone’s syndrome,heart problems,childhood heart defect
Siouxempiremlh.org  ~   Site Info   Whois   Trace Route   RBL Check  
wowsiouxcity.com Sioux City, Iowa, United States, wowcities.com
wowsiouxcity sign help popup close sioux city states united iowa wowcities com page portal loading wow new add group cities settings tab description categorydelete groupedit widget categoryedit layoutedit privilegesadd pages icondelete connect organize album albummanage keyworddelete share hover shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish
Wowsiouxcity.com  ~   Site Info   Whois   Trace Route   RBL Check  
tonyerickson.com Tony Erickson - Sioux Falls, SD - Hegg, REALTORS®
tonyerickson tony erickson hegg realtors® sioux falls web directly site click frames page uses browser doesn support
Tonyerickson.com  ~   Site Info   Whois   Trace Route   RBL Check  
dreamhomevision.com Tony Ratchford Group | Home
dreamhomevision home ratchford group tony sioux falls mls photo listings south arbor grand read icon reciprocity broker featured hegg realtors dream house listing newsroom pitfalls process beds baths image market size park newport old yankton cross cir trl slaten hill
Dreamhomevision.com  ~   Site Info   Whois   Trace Route   RBL Check  
alienandco.com Home
alienandco home falls sioux piercings alien tattoos ave
Alienandco.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 418/585« Previous416417418419420Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com