sioux - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Sioux: 11,280 results found.

bigsiouxscreen.com Big Sioux Screen Print, LLC
bigsiouxscreen usd print sioux screen big llc products contact view visa mastercard client home aqua login cart product search items promotional use events business quick real community professionals politics healthcare estate bestow financial introduction charity sponsorship recognition charities admin legal
Bigsiouxscreen.com  ~   Site Info   Whois   Trace Route   RBL Check  
ashtonsphotography.com Sioux Falls Real Estate Photography
ashtonsphotography estate real photography sioux falls joomla site minneapolis valid css xhtml validity welcome new beginners architectural templates ltr com design custom rtl youjoomla gpl license gnu atom rss paul club cities twin website using just want way read specializes
Ashtonsphotography.com  ~   Site Info   Whois   Trace Route   RBL Check  
missouririverconf.org Missouri River Conference
missouririverconf default conference missouri river member schools sioux city bluffs council west north scheduler login rschooltoday powered athletic bluff abraham heelan bishop home east lincoln luton thomas sergeant jefferson calendar
Missouririverconf.org  ~   Site Info   Whois   Trace Route   RBL Check  
siouxsports.com SiouxSports.com - UND Fighting Sioux Sports
siouxsports com sioux und sports fighting logo dakota north michigan apr twitter siou quantcast xsports fightingsioux football hockey spring game http bit green white schedule undfootball poll men audio broadcast coverage team standings ncaa scoreboard gwfc fcs rankings players wcha
Siouxsports.com  ~   Site Info   Whois   Trace Route   RBL Check  
auto-land-sf.com Used Cars & Trucks - Sioux Falls, SD
used trucks cars falls sioux sales car land auto directions location autoland instantly contact sf visit com www website webvisible map email best wait vehicles financing great quality prices message business close credit window phone perfect problems past deal getting
Auto-land-sf.com  ~   Site Info   Whois   Trace Route   RBL Check  
fallschurch.cc Falls Church | Sioux Falls, South Dakota
fallschurch falls south church dakota sioux giving vision contact story home photography finished info photos marie friday asburyfinished grange coming times service soon avenue hours office phone tues
Fallschurch.cc  ~   Site Info   Whois   Trace Route   RBL Check  
wowsiouxfalls.com Sioux Falls, South Dakota, United States, wowcities.com
wowsiouxfalls sign help close popup sioux falls states united south dakota wowcities com page portal loading wow new add group settings cities groupedit categoryedit tab description widget layoutedit categorydelete album privilegesadd icondelete pages keyworddelete organize connect albummanage baloon hover traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish
Wowsiouxfalls.com  ~   Site Info   Whois   Trace Route   RBL Check  
fallscityconstruction.com Falls City Construction: Sioux Falls, SD: About Us
falls city construction company sioux falls, lydell larson, tom heckel, home improvement remodeling,bathroom remodeling,kitchen remodeling,general contractor sioux falls,home remodel,home addition,home insurance repair,remodeling contractor,contractor sioux falls,roof contractor sioux falls,sioux falls home improvement,basement remodel,bath remodel,small bathroom remodel,house remodel,remodel contractor,remodel company,home additon plan,building home addition,home addition floor plan,home remodeling addition,home improvement addition,home owner insurance claim,home insurance claim,property insurance claim,insurance claim water damage
Fallscityconstruction.com  ~   Site Info   Whois   Trace Route   RBL Check  
siouxfallslwv.org The League of Women Voters of Sioux Falls
siouxfallslwv lwv league women falls sioux voters contact join elections calendar events email easy web webmaster organization public policy information form purpose example response send collect cookies use users data used satisfy april copyright california south dakota reserved rights product
Siouxfallslwv.org  ~   Site Info   Whois   Trace Route   RBL Check  
preferredmanagementllc.com Real Estate Management by Preferred Management LLC Sioux Falls
real estate management sioux falls, rental listings sioux falls
Preferredmanagementllc.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 423/585« Previous421422423424425Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com