socal - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Socal: 6,582 results found.

bbuzz.net This page has moved...
bbuzz skylights moved page html org socal http www
Bbuzz.net  ~   Site Info   Whois   Trace Route   RBL Check  
spicetradersteas.com Spice Traders And Teas
spicetradersteas renfair spice socal com teas traders www products necessarily statements intended information physician conditions come qualified diagnosis guidance proper visit medical irwindale cawww join facebook seek april renaissance faire weekend original cure purpose educational offered website evaluated used presented
Spicetradersteas.com  ~   Site Info   Whois   Trace Route   RBL Check  
socalforsalenow.com SoCal for Sale Now
socalforsalenow realeflow sale socal fast home sell complete offer email form months need right fair report special receive free titled situation immediatelywithin days powered page just delivered immediately matter dollar peace quickly size price close cash reason buy houses location
Socalforsalenow.com  ~   Site Info   Whois   Trace Route   RBL Check  
socalmuscle.com SoCal Muscle Car Club
socalmuscle car club muscle socal cars articles information avic message electric know generation did police hummer design intialize technology llc web biofuels green map runs comparison board renewable navi fuels view pioneer apr comments street shawn rader friday modified racing
Socalmuscle.com  ~   Site Info   Whois   Trace Route   RBL Check  
socaltt.com SoCalTT Home
socaltt home cycle socal october socall application yahoo group roads does wheeled check event angeles los events upcoming rally stickers hotel form dirt straighter gravel cost shirt included patch support join email photos info past information dinner vehicle chase desert
Socaltt.com  ~   Site Info   Whois   Trace Route   RBL Check  
socaltechno.com Got Project? - SoCal Techno wants to do it!
socaltechno php experiments project techno socal got wants systems controller arduina training offering atmel robust finished documentation provide turning integration components using optimally useful interested contracting mysql micro shows cake working html> currently offer services software special hardware sub design
Socaltechno.com  ~   Site Info   Whois   Trace Route   RBL Check  
wrobb.com William B Robb – Socal contact information
wrobb william robb wordpress information contact socal theme minicard resume vcard tim home damme van inspired download twitter facebook myspace linkedin lastfm photo copyright email meaddress homeabout facebooklastfmlinkedinmyspacetwitterwordpress usa cantonohio akron inthecloud feed comments rsd powered page
Wrobb.com  ~   Site Info   Whois   Trace Route   RBL Check  
ligneroset-socal.com Ligne Roset contemporary European furniture
flash ligneroset socal ligne furniture roset contemporary european player content requires macromedia
Ligneroset-socal.com  ~   Site Info   Whois   Trace Route   RBL Check  
socal-appraisals.com Site off-line | Drupal
drupal handbook appraisals site line socal database hosting drpl provider settings hooddesi help contact access user localhost denied running error mysql ensure problems try technical available currently later thank php file check maintainer understanding server
Socal-appraisals.com  ~   Site Info   Whois   Trace Route   RBL Check  
socal-inspectors.com SO CAL INSPECTORS, INC.
inspectors cal socal inspection email home services inspections property draft occupancy form fannie disaster mae rush interior loss preservation san suite marcos office fax rancheros verification date interview work address sale bankruptcy experts welcome mortgage field goal questionare inspector coverage
Socal-inspectors.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 231/345« Previous229230231232233Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com