specialist - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Specialist: 206,262 results found.

eye-globalsolutions.com Eye Global Solutions - Specialist Risk Consultancy
Eye Global Solutions
Eye-globalsolutions.com  ~   Site Info   Whois   Trace Route   RBL Check  
k9specialist.com K-9 Specialist LLC - Zeeland Michigan, Dog Training in the West Michigan Area.
For nearly twenty years, K9 Specialist has been training and rehabilitating dogs. By using a “pack leader” mentality, K9 Specialist creates well balanced, mentally stable & respectful family pets. K9 Specialist also offers dog boarding, Power of the Pack play days, puppy training courses, in-home aggression therapy for all types types of dogs, big and small.
K9specialist.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: k9specialist.net
rankingme.net Ranking Me High Ranking Specialist & Web Marketing Specialists
Ranking Me Web Marketing Specialist High Ranking Specialist SEO SEM, and Web Design We are here to help you grow
Rankingme.net  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: rankingme.org
anjmobility.com A&J MOBILITY SPECIALIST LLC - Home
                                                                                                             We Service All Makes and Models If you do not see the product you're looking for Please Call Us. We have 1000's of items available!    We offer a w
Anjmobility.com  ~   Site Info   Whois   Trace Route   RBL Check  
prodentis.co.uk ProDentis - Specialist Dental Clinics
Welcome to our website! We hope this lecture will help you to learn more about ProDentis ...
Prodentis.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
affordablesiding.net Window Specialist Krakow, WI - Affordable Siding 920-660-1258
Affordable Siding of Krakow, WI is a siding, windows, and doors specialists. We have over 40 years of experience. Fully insured and licensed. Call 920-660-1258.
Affordablesiding.net  ~   Site Info   Whois   Trace Route   RBL Check  
calabasascertifiedfamilylawspecialist.com CALABASAS CERTIFIED FAMILY LAW SPECIALIST
Calabasas Certified Family Law Specialist
Calabasascertifiedfamilylawspecialist.com  ~   Site Info   Whois   Trace Route   RBL Check  
cityofdiscovery.co.uk Providing Specialist Web Design and Advertising Services for the Dundee Area
Providing Specialist Web Design and Advertising Services for the Dundee Area. Specialising in search engine optimising, flash and graphic design.
Cityofdiscovery.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
gabrielerusso.com Consulente SEO Specialist per il Posizionamento su Google
Gabriele Russo, Consulente Seo Specialist, si occupa del posizionamento naturale del sito internet del Cliente sui motori di ricerca, quindi non fa pay per click, non utilizza link sponsorizzati o adwords: Seo Specialist è uno specialista che sa esattamente come deve essere strutturato il contenuto del sito internet e quale deve essere il sistema web che permette la più alta visibilità dell'Azienda del Cliente sulla rete attraverso il suo sito internet.
Gabrielerusso.com  ~   Site Info   Whois   Trace Route   RBL Check  
natefoster.com NATE FOSTER - RESIDENTIAL SPECIALIST,
NATE FOSTER - RESIDENTIAL SPECIALIST, for sale: , bed 1, bath 1, sqft home, , , ,
Natefoster.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 219/575« Previous217218219220221Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com