specialty - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Specialty: 139,885 results found.

fahrenheitcoffee.com Fahrenheit Coffee - Toronto's Newest Specialty Coffee Shop
Specialty Coffee is an Art and a Science. Our Coffee is brewed in 5 different ways - Espresso, French Press, Pour Over, Siphon Vaccum Pot and Drip. We produce each cup with the highest attention to quality.
Fahrenheitcoffee.com  ~   Site Info   Whois   Trace Route   RBL Check  
flspecialtysystems.com The FL SPECIALTY SYSTEMS Family
Gate operators,CCTV,camera systems,traffic spikes,phone entry units,keypads,magnetic locks,swing gates,slide gates,sliding gates,walk gates,security cameras,DVR,infrared cameras,budget installations,low prices,access controls
Flspecialtysystems.com  ~   Site Info   Whois   Trace Route   RBL Check  
fwsconstruction.net FWS Construction: Concrete Specialty
Concrete Contractor Lodi CA (209)369-7000
Fwsconstruction.net  ~   Site Info   Whois   Trace Route   RBL Check  
gothicpunkspecialtyhardware.com Gothic Punk Specialty Hardware
Machined metal accessories for dark fashions. We make spikes, belts, cuffs, D rings, goggles, collars, jackets and more. We sell direct and wholesale.
Gothicpunkspecialtyhardware.com  ~   Site Info   Whois   Trace Route   RBL Check  
indoorgardencenter.com Specialty Garden Center - Vista CA
vista hydroponics and indoor garden store.
Indoorgardencenter.com  ~   Site Info   Whois   Trace Route   RBL Check  
integramed.com IntegraMed Specialty Healthcare Services
Products and services for medical providers and consumers in the Fertility Treatment and Vein Treatment medical sectors.
Integramed.com  ~   Site Info   Whois   Trace Route   RBL Check  
judicakes.com judicakescom - unique specialty gifts
judicakes.com are unique gifts for special occasions BABY diaper cakes; TODDLER pullup cakes; WEDDING; GRADUATION; MOM/DAD; PETS; MORE
Judicakes.com  ~   Site Info   Whois   Trace Route   RBL Check  
k9kruzers.com K-9 Kruzers Specialty Dog Walking
Dog walking and vacation care servicing Chicago south side. We specialize in reactive and aggressive dogs.
K9kruzers.com  ~   Site Info   Whois   Trace Route   RBL Check  
katrinaalana.com KatrinaAlana, Handmade Specialty Products
KatrinaAlana : - Portraits and Custom Prints Kokeshi Dolls Ring Pillows Invitations & Save the Dates Dresses Soak Swimwear Sealing Wax Wax Seal wax seals, sealing wax, wrap dresses, soak swim wear, Singapore, online shopping
Katrinaalana.com  ~   Site Info   Whois   Trace Route   RBL Check  
kishhealthfamilyandspecialtycare.com KishHealth Family & Specialty Care
Kishwaukee Community Hospital is a community hospital in Northern Illinois. It has many of the technological advances found in regional medical centers. Located 60 miles west of Chicago, it serves the Northern Illinois University community and is the resource hospital for DeKalb County ambulance providers.
Kishhealthfamilyandspecialtycare.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 209/606« Previous207208209210211Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com