springfield - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Springfield: 36,907 results found.

kilroys.com Kilroys Restaurant & Sports Bar - Springfield, VA
Kilroys Restaurant - Seafood, Prime Rib, and Steak at this large restaurant, lounge and sports bar decorated in nostalgic '40's - '50's décor, Lunch, Dinner, Catering, Parties, Best Happy Hour - in Springfield, Fairfax County, Virginia VA and near Alexandria, Annandale, Fairfax City
Kilroys.com  ~   Site Info   Whois   Trace Route   RBL Check  
us-financialservices.com US Financial Services | Springfield MA
Your one source for financial information on CPA, Tax Attorneys, Accountants and accounting software.
Us-financialservices.com  ~   Site Info   Whois   Trace Route   RBL Check  
springfieldautoalarms.com Auto Alarms Springfield, IL - Bob's Electronics 217-553-1957
Over 22 years experience. Bob's Electronics provides car alarms, keyless entry and window tinting to the Springfield, IL area. Call 217-553-1957.
Springfieldautoalarms.com  ~   Site Info   Whois   Trace Route   RBL Check  
springfieldmalpracticelawyers.com Springfield Malpractice Lawyers | Top Malpractice Lawyers in Springfield, MO
Springfield lawyer - Let us help you find the top lawyer in Springfield, MO. Find addresses, phone numbers, driving directions, reviews and ratings on springfieldmalpracticelawyers.com
Springfieldmalpracticelawyers.com  ~   Site Info   Whois   Trace Route   RBL Check  
ezstoragespringfield.com Storage Service Springfield, OH ( Ohio ) - Preston's Storage
Preston's Storage provides convenient and secure storage services in Springfield, OH. Call us today at 937-215-0477 for your storage needs.
Ezstoragespringfield.com  ~   Site Info   Whois   Trace Route   RBL Check  
patentlawyerspringfield.com Patent Lawyer Springfield
Ready to patent your new invention? A patent lawyer in Springfield could speak with you on how to most ideally construct your patent application.
Patentlawyerspringfield.com  ~   Site Info   Whois   Trace Route   RBL Check  
springfieldgreen.com.au Springfield Green
Modern 3 Bedroom Townhouse with Ensuited & Double Lockup Garage, Springfield Green is a modern quiet 93 unit complex with 2 Swimming Pools BBQ's and a Gymnasium for the enjoyment of tenants.
Springfieldgreen.com.au  ~   Site Info   Whois   Trace Route   RBL Check  
springfieldlimoservices.com Springfield Limo Services | Deals on Limo Services in Springfield, MO
Springfield Limo Services - Let us help you find the top Limo Services in Springfield, MO. Find addresses, phone numbers, driving directions, reviews and ratings on springfieldlimoservices.com
Springfieldlimoservices.com  ~   Site Info   Whois   Trace Route   RBL Check  
headofthehunt.com Business Promotion Graphic Design | Springfield, NJ
Project the right image for your company with Head of the Hunt, providing business promotion services, graphic design, and branding in Springfield, New Jersey.
Headofthehunt.com  ~   Site Info   Whois   Trace Route   RBL Check  
springfieldilchildcaredaycare.com Day Care Springfield, IL Doll House 217-523-5707
Doll Housea safe and caring environment for your children to Springfield, IL.Call 217-523-5707 now for more information.
Springfieldilchildcaredaycare.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 65/609« Previous6364656667Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com