subtle - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Subtle: 5,131 results found.

b-hstudios.com B-H Studios
studios hstudios art glass metalweave bowl studio wordspop home skylight contact slideshow b celebrate sparkling brilliant logo light weave color platter rainbow green colors subtle paintings expressing reserved natural rights aboutcontactmetalweaveskylightslideshow pottery copyright serenity northwest pacific metallic plate view rsd
B-hstudios.com  ~   Site Info   Whois   Trace Route   RBL Check  
blakephillipkimball.com Blake Phillip Kimball - Digital Media & Advertising Effectiveness Sales
blakephillipkimball facebook twitter linkedin link blog blake sales kimball phillip digital media effectiveness advertising god subtle specializing professional look white tasteful coloring font
Blakephillipkimball.com  ~   Site Info   Whois   Trace Route   RBL Check  
mobedesignstudio.com Welcome to Mobe Design
mobedesignstudio mobe welcome design home texture let glisten soft subtle elegance look elegant enjoy beauty invite gallery prints artistry rendered distinctive
Mobedesignstudio.com  ~   Site Info   Whois   Trace Route   RBL Check  
patrickwalkerrussell.com Home
patrickwalkerrussell home fibers pieces antrim gallery handweaving links homepagephoto contact textures pronounced simply destined mélange heirlooms elegant hand enticing tempting visually natural handwoven touch subtle spectrum naturally nature rendered colors dyed
Patrickwalkerrussell.com  ~   Site Info   Whois   Trace Route   RBL Check  
seri-worldwide.com SERI-Worldwide
worldwide seri jpg waltportrait subtle energy articles research areas forums groups information encourage focus energies organization sharing use material papers website hear email list reviews journal designed support various observational love post online dialogue site create listed request vision community
Seri-worldwide.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: seri-worldwide.org
katychang.com mer-chan
katychang chan mer news shop media cute technology technocuddly food soy subtle incorporate fun things artisanal ways design products projects make eat innovative store negotiate art films short produce documentaries arty geeky curated highlight carefully asia stuff best
Katychang.com  ~   Site Info   Whois   Trace Route   RBL Check  
mer-chan.com mer-chan
chan mer shop news media technocuddly technology cute food projects soy incorporate things fun subtle ways products design artisanal eat make innovative store negotiate art films short produce documentaries arty geeky curated highlight carefully asia stuff best
Mer-chan.com  ~   Site Info   Whois   Trace Route   RBL Check  
oh2o.com Optimal Health Organization > Main
oh2o health organization optimal main formulae click offer example photography work kirlean energy subtle oho supplementation sef membership referral gain members join legal like disclaimer access contact number direct toll party referring application include free field comes individuals form complex
Oh2o.com  ~   Site Info   Whois   Trace Route   RBL Check  
durgadreams.com Durga Dreams
Durga, Durga Dreams, Mythical Art, Aperspectival Integral Art, Subtle Realms Art, Poetry and Art, Collages, Metaphysical Art, Magical Art, Highly Original Post-Modern Fine Art, Hypnagogic Art, San Francisco Art, Feminine Art
Durgadreams.com  ~   Site Info   Whois   Trace Route   RBL Check  
jbmiacity.com ...JBMiaCity
jbmiacity tumblr lemon flash ask rss random page powered mobile archive feed ago months posted nyc kitchen central summer smitten park thanks lime cake subtle pound icing delicious style mmm thai chicken wells slide railing believe sure drunkstin according following
Jbmiacity.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 182/308« Previous180181182183184Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com