suppliers - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Suppliers: 112,557 results found.

thewtdstore.com Write That Down - University T-Shirt Suppliers
thewtdstore write university shirt suppliers events slide image button organizations marcusjaustin forward terms service dynamic www cart initiatives products home contact login com shopping http read heart shirts wtd slogan good awareness social communities causes marcus rutgers supporting buy logo
Thewtdstore.com  ~   Site Info   Whois   Trace Route   RBL Check  
tracowipe.com T R A C O W I P I N G P R O D U C T S
tracowipe traillco wiping suppliers welcome prods products
Tracowipe.com  ~   Site Info   Whois   Trace Route   RBL Check  
trademama.com Wholesale, Wholesalers, Suppliers & Manufacturers Trade Directory
trademama supplies trade directory wholesalers manufacturers wholesale suppliers office home complete signs phone quantcast custom sporting tools goods toys appliances construction electronics luggage food automotive apparel jewelry lighting health furniture bags categories power garden baby hand fashion consumer computer building
Trademama.com  ~   Site Info   Whois   Trace Route   RBL Check  
traveldirectresponse.com Welcome to Travel Direct
traveldirectresponse travel welcome direct privacy policy agents terms conditions suppliers com thekuhngroup sales copyright bruce communications hills group kuhn division traveldirect blvd suppliersdiscover incredibly cost informed number agentsjoin growing effective ways fax ventura suite telephone service advertise product woodland
Traveldirectresponse.com  ~   Site Info   Whois   Trace Route   RBL Check  
travel-ring.com Travel Ring – Suppliers for travel industries
travel ring industries suppliers company choose category industry business describes keywords city virgin conditions terms service state use phone establish mail fax services commas customer example arabiasenegalserbiaseychellessingaporeslovakiasloveniasouth marinosaudi koreaspainsri lankast africasouth fyrmadagascarmadeiramalawimalaysiamaldivesmalimaltamartiniquemauritaniamauritiusmexicomoldovamonacomontenegromoroccomozambiquemyanmarnamibianepalnetherlds coastjamaicajapanjordankazakhstankenyakuwaitlaoslatvialebanonlesotholithuanialuxembourgmacedonia polynesiagambiagermanyghanagibraltargreecegrenadaguatemalaguineahaitihollandhungaryicelandindiaindonesiairanirelandisraelitalyivory guianafrench kitts caledonianew irelandnorwayomanpakistanpanamaparaguayperuphilippinespolandportugalpuerto zealandnicaraguanigerianorthern ricoqatarreunionromaniarussiarwandasan
Travel-ring.com  ~   Site Info   Whois   Trace Route   RBL Check  
tropicaltimberco.com Tropical Timber - Africa Timber Manufacturers & Suppliers
tropicaltimberco timber tropical africa manufacturers suppliers world products premium represented elephant cameroon lodge based partner willing company information importers cooperate naari presence selling woods trading wood specializing goal new quality offer extend leads clients
Tropicaltimberco.com  ~   Site Info   Whois   Trace Route   RBL Check  
tssenterprises.net Tawakkul Steel Suppliers Enterprises - Home Page
tssenterprises sourcing strategic company products services clients enterprises suppliers steel home page tawakkul enquiries business experience experence site map sitemap libero sed elit amet nunc est faucibus sit vel leo aliquam tellus nulla vitae congue nisl consequat pharetra ullamcorper convallis
Tssenterprises.net  ~   Site Info   Whois   Trace Route   RBL Check  
tungstencarbidedies.com TungstenCarbideDies .com - TungstenCarbideDies Directory of Manufacturers & Suppliers
tungstencarbidedies directory manufacturers dies com die suppliers molding plastic casting industrial diesplastic drawing dieforming diesdie list dieplastic automotive handling use molds steel punching piercing injection compound blanking forming related directories industrialdirectory products product search terms page diepunching diepiercing diespress diesstamping
Tungstencarbidedies.com  ~   Site Info   Whois   Trace Route   RBL Check  
ukcustomshop.co.uk UK Custom Shop - suppliers of fine sporting products
Ruger 10/22, Mauser 98, Remington 700, Sako, Gun, Rifle, Full Bore, Small Bore, Rimfire, Benchrest, Target, Gunsmith, Riflesmith, Reflex suppressors, Custom, Competition, Moderator, Action, Volquartsen, Lilja, Shillen, Power, Wildcat, Tooley, Midway, Bedding, Trigger, Air Rifles, Air Guns, Airsoft, Webley, Shotgun,Sporting rifle, Bullseye, Practical, Shotgun, Bipods,Stalking, Shooting, Hunting, Deer Stalking, Sporting Agent, Roe Deer, Sika Deer, Red Deer, Muntjac, Fallow Deer, Chinese Water Deer.Goats, Level 2 Assessment, Varmint, High Seats, BDS, BASC, Gold Medal,Knifes, Scopes, Ammunition, Actions, Reloading, Joker, Sights, Reloading components, Bullets, Redding, RCBS, Lee, Harris, Fire Point, Optics, Reddot, Components, Powder, Primers, Brass, Cases,katana, Samurai, Sword, Imports, USA, Midway, Hogue,
Ukcustomshop.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
ukspecialistcars.com UK Specialist Cars, suppliers of used vehicles in Spain
ukspecialistcars cars vehicles used specialist spain stocklist suppliers browse spanish new click suzuki hyundai home google contact make search hand drive stock right including audi view ford peugeot costa welcome blanca lhd latest selection bmw impressive marques renault benz mercedes
Ukspecialistcars.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 595/605« Previous593594595596597Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com