suvs - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Suvs: 17,645 results found.

omahafords.com Rusty Eck Ford | Omaha, Sioux City, Des Moines, Lincoln, St. Joseph and Kansas City Dealers | New & Used Cars, Trucks and SUVs
Welcome to Rusty Eck Ford! Are you looking for high performance Ford dealers in Omaha, Sioux City, Des Moines, Lincoln, St. Joseph and Kansas City? If you are a performance lover and live in Nebraska, Iowa, Kansas or Missouri and want to buy a new or used vehicle, search our Ford inventory. You won't save billions, Omaha NE ... but you'll save a lot. Looking for used cars, trucks, suvs or vans? Find Chevrolet, Chrysler, Dodge, Ford, GMC, Honda, Hyundai, Infiniti, Jeep, Mazda, Mitsubishi, Toyota and more! Rusty Eck Ford is a performance dealer that makes it easy for you to find the right vehicle for sale - with all the right options. Check out our selection of new, certified preowned cars for sale. ''If you don't come and visit me today, I can't save you any money!'' - Rusty Eck
Omahafords.com  ~   Site Info   Whois   Trace Route   RBL Check  
richmondfordexplorer.com The All-New 2011 Ford Explorer SUVs :: Richmond, Virginia :: Richmond Ford Lincoln
The 2011 Ford Explorer is the most capable Explorer SUV ever. Starting with a strong and lightweight structure – the strongest, lightest one yet, thanks to high tech materials and advanced forming technology. One of the most innovative features in the 2011 Explorer is one you cannot see.
Richmondfordexplorer.com  ~   Site Info   Whois   Trace Route   RBL Check  
thomasandsonauto.com Used Cars | Used Trucks Dade City 33525 | Thomas Auto Mart Inc.
Used Cars | Used Trucks Dade City 33525 | Thomas Auto Mart Inc. - Cars Trucks Vans SUVS Convertables Motorcycles
Thomasandsonauto.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: youronlinedealership.com - thomasautomart.com
cogswellmotors.com Cogswell Motors | Russellville, AR | Morrilton, AR | New and Used Cars Trucks SUVs
Welcome to Cogswell Motors!
Cogswellmotors.com  ~   Site Info   Whois   Trace Route   RBL Check  
rftcarclearance.com Rochester Minnesota Used Dealer | Rochester Clearance Center | New Used, Used Cars, Trucks, SUVs in MN
Rochester Clearance Center, your Minnesota Used car dealership serving Rochester and surrounding areas. Auto Dealership selling new and used cars, trucks, and SUVs.
Rftcarclearance.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: rochestercarclearance.com
texsautosales.com Tex's Auto Sales: Pittsburgh, Pennsylvania - your source for pre-owned cars, trucks and SUVs
Tex's Auto Sales of Pittsburgh Pennsylvania, your preowned car, truck and SUV dealer
Texsautosales.com  ~   Site Info   Whois   Trace Route   RBL Check  
usedinfinitiorlando.com Used Infiniti cars and SUVs for sale in Orlando and Longwood, Florida.
Browse a great selection of used Inifniti cars and SUVs at Michaels Autos in Orlando, Florida. Financing is available and trade ins are welcome.
Usedinfinitiorlando.com  ~   Site Info   Whois   Trace Route   RBL Check  
autoloansrochester.com Marketplace Suzuki | Used Cars & New Suzuki Cars, Trucks, SUVs in Rochester, NY
Marketplace Suzuki is a Rochester Car Dealer providing Used Car Sales, Suzuki Cars & Trucks as well as Service. We stock an excellent selection of New and Used Cars, Trucks, Vans, Wagons, and SUVS. We also are happy to help Buffalo, Syracuse, Niagara Falls, Binghamton, and all other Upstate and Western New York Residents.
Autoloansrochester.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: carservicemarketplace.com - marketplace-suzuki.com - mpsuzuki.com - rochestermarketplacesuzuki.com - rochesterusedsuzuki.com - thriftyatmarketplacesuzuki.com - thriftycarsalesatmarketplace.com
carmusing.com Car Musing - Global marketplace for used vehicles
Car Musing is a global marketplace for used vehicles. We offer Free Car Classifieds - Efficient Promotion of Cars, SUVs, Vans, Trucks, Motorcycles, Motorhomes, Boats, Yachts, Construction and Agriculture vehicles etc.
Carmusing.com  ~   Site Info   Whois   Trace Route   RBL Check  
greensborovolvo.com Home Crown Volvo of Greensboro Greensboro NC
Crown Volvo Greensboro is proud to be a Triad area Volvo Dealership with New 2011 Volvos, Used Volvos in Greensboro, Certified Volvos, Auto Repair & Volvo Service and more. Looking for Volvo Parts or Financing for a Used Car in Greensboro? Crown Volvo should be your one and only stop.
Greensborovolvo.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 73/431« Previous7172737475Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com