tank - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Tank: 67,599 results found.

bestseptictankcleaning.com Best Septic Tank Cleaning
Quality service septic tank cleaning for Fort Bend County, Texas: Richmond, Rosenberg, Sugar Land, Katy, Fulshear, Simonton, Wallis, Needville, and surrounding areas.
Bestseptictankcleaning.com  ~   Site Info   Whois   Trace Route   RBL Check  
citytank.com City Tank | abbigliamento, scarpe e accessori moda
City Tank Faneschi: abbigliamento, scarpe e accessori moda. Prodotti e offerte speciali sul sito
Citytank.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: faneschi.com
nolanboiler.net Nolan Boiler & Tank Service Inc | Chicago, IL 60620 | DexKnows.com™
Nolan Boiler & Tank Service Inc in Chicago, IL 60620. Find business information, reviews, maps, coupons, driving directions and more.
Nolanboiler.net  ~   Site Info   Whois   Trace Route   RBL Check  
septictankcleaningfayetteville.com Septic Tank Cleaning Services in Spring Lake & Fayetteville, NC - Local Search - LocalEdge.com
Do you need septic tank cleaning in Fayetteville, NC? Then call Clinton Road Septic Tank Service at (910) 483-5867!
Septictankcleaningfayetteville.com  ~   Site Info   Whois   Trace Route   RBL Check  
watertanklids.com Toilet tank lids brands Kohler, Lamosa, Kokomo Pottery, Manajese, Luxor, Maddocks Sons and a total of over 11,000 replacement used obsolete toilet tank covers and lids
Commode toilet tank lids made by Kohler, okomo Pottery, Manajese, Luxor, Maddocks Sons and Lamosa as well as mancesa and even manajese
Watertanklids.com  ~   Site Info   Whois   Trace Route   RBL Check  
waukeshaportabletoiletsandseptic.com Septic Tank Waukesha, WI - Bill's Portable Toilets & Septic
Bill's Portable Toilets & Septic provides septic cleaning service and portable toilet rental center to Waukesha, WI. Call 262-563-9523 For Inquiries.
Waukeshaportabletoiletsandseptic.com  ~   Site Info   Whois   Trace Route   RBL Check  
alapbangladesh.com AlapBangladesh.com - Think Tank
Networking, ideas and expertise for Bangladesh and beyond - Open Think tank of Bangladesh
Alapbangladesh.com  ~   Site Info   Whois   Trace Route   RBL Check  
divinereefer.com Home Page - divinereefer
A look into the creation of my 90 Gallon Reef tank and the trials and tribulations that come along the way.
Divinereefer.com  ~   Site Info   Whois   Trace Route   RBL Check  
fondapol.org Un Think Tank libéral, progressiste et européen
Fondapol, la Fondation pour l'innovation politique contribue au pluralisme de la pensée et au renouvellement du débat public. Elle s'inscrit dans une perspective libérale, progressiste et européenne.
Fondapol.org  ~   Site Info   Whois   Trace Route   RBL Check  
septictankpumpingmesa.com Septic Services, Septic Tank Pumping, Septic Inspections, Septic Cleaning, Septic Locate – Mesa, Arizona by Green Arrow Environmental
Septic Tank Pumping, Septic Inspections and Septic Cleaning Services in Mesa, Arizona
Septictankpumpingmesa.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 188/591« Previous186187188189190Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com