tasting - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Tasting: 32,628 results found.

wineonthelake.com Wine on the Lake - Pennsylvania's Premiere Wine Tasting Event!
Wine on the Lake - a gourmet wine tasting event in Erie, PA
Wineonthelake.com  ~   Site Info   Whois   Trace Route   RBL Check  
4grain.com 4Grain Home - Healthy, Great-Tasting Eggs
4 Grain eggs come from hens fed a wholesome diet of four all-natural golden grains - corn, flax, milo and wheat - that is enhanced with protein-rich soy and Vitamin E.
4grain.com  ~   Site Info   Whois   Trace Route   RBL Check  
jackiegamber.com …::Author Jackie Gamber::… | Book Tasting and Story Telling
Book Tasting and Story Telling
Jackiegamber.com  ~   Site Info   Whois   Trace Route   RBL Check  
chachies.com Chachies - America's Best Tasting Fresh Salsa
Chachies is best tasting fresh salsa. Never cooked, always fresh, kosher... Visit for receipes, product info and to find a store near you.
Chachies.com  ~   Site Info   Whois   Trace Route   RBL Check  
nulifefoods.com NuLife Foods – Healthy great tasting GFCFSF foods
Healthy great tasting GFCFSF foods for Autism
Nulifefoods.com  ~   Site Info   Whois   Trace Route   RBL Check  
romelimousines.org Rome Limousine
Rome Limousine excursion to Imperial Rome with all the highlights of Ancient Rome and Vatican: Colosseum Rome, Pantheon Rome, Roman and Imperial Forums, Capitol Hill, the Vatican Museums with the Sistine..
Romelimousines.org  ~   Site Info   Whois   Trace Route   RBL Check  
whisky-web.de 1. Malt Whisky & Laird Society of Munich
1. Malt Whisky & Laird Society of Munich
Whisky-web.de  ~   Site Info   Whois   Trace Route   RBL Check  
huntersrunwinebarn.com Hunters Run Wine Barn | Wine Tasting Loudoun County Northern Virginia Hamilton
Loudoun County wine tasting barn located in Hamilton near Leesburg and Purcellville VA
Huntersrunwinebarn.com  ~   Site Info   Whois   Trace Route   RBL Check  
familywineriesdrycreekvalley.com Family Wineries Tasting Rooms Dry Creek Valley and Kenwood Sonoma County CA
Over a dozen Family Wineries in 2 locations Dry Creek Valley, Healdsburg and Kenwood, Heart of Sonoma Valley, Sonoma County, California
Familywineriesdrycreekvalley.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: familywineriestastingroom.com - familywines.com
liquidremedy.com ULIVE - Great Tasting Liquid Herbal Drink Additive and Effective Natural Drink Shots
ULIVE is the best brand of liquid herbal supplements
Liquidremedy.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: uboneappetit.com - ulibido.com - ulivefree.org - ulivelife.com - usleepeasy.com - usleepez.com - usleepezy.com
 


Page 55/523« Previous5354555657Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com