tkm - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Tkm: 595 results found.

tkmperu.com La Web del PERÚ para el Mundo
tkmperu del web mundo para perú tkm pack por campañavelocidad visitas transferencia autoresponder limitado aprovechala registro tiempo oportunidad ilimitada tienda solo todo lanzamiento próximo us$ anuales alojamiento dominio virtual ofrece hosting
Tkmperu.com  ~   Site Info   Whois   Trace Route   RBL Check  
thekauaimarathon.com The Kauai Marathon
The Kauai Marathon,Marathons,Marathon,Running,Adventure Running,Kauai,Hawaii,Hawaiian,Endurance,Track and Field,Hiking,Family Vacation,Road biking,Triathlon,Mountaineering,Field,Weight Training,Health,Fitness,Dean Karnazes,Health and Fitness,Nutrition,Nike,Runners World Magazine,Running Times Magazine,EnduranceVacation,Family vacation,Vacationing with my family
Thekauaimarathon.com  ~   Site Info   Whois   Trace Route   RBL Check  
centraldelcaravaning.com CENTRAL DEL CARAVANING
centraldelcaravaning masters oposiciones caravaning del central oferta gran tec contadores web estadisticas gratis tkm free tour adria altea
Centraldelcaravaning.com  ~   Site Info   Whois   Trace Route   RBL Check  
thekingsmusician.org The King's Musician Educational Foundation
thekingsmusician king musician foundation educational stuff contact jeff home interference bible society music international help news tkm page newsletter new read experiencing frames day verse current provided avenue beaumont events calder copyright visit channel information solve kfdm area notice live
Thekingsmusician.org  ~   Site Info   Whois   Trace Route   RBL Check  
techknowmonks.com TechKnow Monks
techknowmonks techknow monks support broadcasting publishing facebook twitter training midland login blog client ministries feed page tkm step bible church academy unlimited discipleship agape classical rsd comments soon stuff organization dedicated christian mission update stream assisting needs bunch coming contact
Techknowmonks.com  ~   Site Info   Whois   Trace Route   RBL Check  
wbfd.net 1974 Cessna 150
wbfd cessna photos view logs intercom annualmore trans ndh complete narco price smoh tkm nav loran northstar com previous left click right photo
Wbfd.net  ~   Site Info   Whois   Trace Route   RBL Check  
umraniyespor.org Ümraniye Spor
umraniyespor spor ümraniye deneme maç cafe iletişim çardak ana tkm bilg sayfa yapı blg alt buraya ekleyin reklam adsense kodunu forum tadlock justin teknik kulüp kadro takımlar ekim tesisler son yazılar yeniler rss bir yenileryenilerarchivessayfalardenemedenemeekim başka wordpress blogu etiketler yorumlar
Umraniyespor.org  ~   Site Info   Whois   Trace Route   RBL Check  
go-kart-parts.co.uk Go Kart Parts
kart parts bargains view rotax paypal sprocket new tkm karting engine bars chain book bid exhaust maintenance teeth sprockets sale wheels kits seat chassis rims petrol carburetor tank plans suit race axles bumper disc torsion trolley clutch valves tyres thermostat
Go-kart-parts.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
xn--hazardezi-mwb.com Hazar Deňzi
hazar deňzi wikipedia hazardezi қаз azə рус فار mwb caspian orbit sea jpg image serhetleşýär azerbaýjan com hazardeňzi tkm bilen türkmenistan eýran russiýa gazagystan xn
Xn--hazardezi-mwb.com  ~   Site Info   Whois   Trace Route   RBL Check  
connectingbodyenergy.com Connecting Body Energy
connectingbodyenergy body energy connecting klinghardt autonomic reiki art home touch testing response polarity reflexes neonatal retained functional development tkm balancing light
Connectingbodyenergy.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 28/36« Previous2627282930Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com