truck - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Truck: 208,615 results found.

forkliftsolutions.info Forklift Truck Solutions
Forklift Solutions deliver a professional service at the right price. We are based Cramlington near Newcastle and offer forklift truck rental, hire and repair services.As a hire specialist Forklift Solutions can deliver great rates with guaranteed service levels. We provide free training with every purchase, local based engineers, parts next day and all inclusive service costsFor more information on any products or services provided by Forklift Solutions please contact usTo request a quotation please complete the from or telephone us to discuss your requirements
Forkliftsolutions.info  ~   Site Info   Whois   Trace Route   RBL Check  
htt-hawaii.com HT&T Truck Center | HOME
HT&T Truck Center is Hawaii’s largest full-service dealership for heavy- and medium-duty trucks, and the sole Hawaii authorized dealer for the Peterbilt, Isuzu, Autocar, McNeilus and E-One brands. Located in Iwilei, Oahu, HT&T Truck Center has a Truck Sales Department, a Parts Department and a Service Department. In addition, we have service and warranty affiliates on Maui, Kauai and the Big Island.
Htt-hawaii.com  ~   Site Info   Whois   Trace Route   RBL Check  
new-york-truck-accident-lawyers.com New York Truck Accident Lawyers - Manhattan Truck Accident Attorneys - Wingate, Russotti & Shapiro
Wingate, Russotti & Shapiro, LLP is a prominent New York City trucking accident law firm. Our New York truck accident attorneys specialize in truck crash injury cases throughout the New York State area.
New-york-truck-accident-lawyers.com  ~   Site Info   Whois   Trace Route   RBL Check  
stauntontruckrepair.com Staunton Truck & Auto Repair
We offer truck and auto repair services, specializing in truck towing, recovery, repair, and road service.
Stauntontruckrepair.com  ~   Site Info   Whois   Trace Route   RBL Check  
truckaccidentlawyernewhampshire.com Truck Accident Lawyer New Hampshire
A directory listing of truck accident lawyer in New Hampshire
Truckaccidentlawyernewhampshire.com  ~   Site Info   Whois   Trace Route   RBL Check  
truckpartsathensga.com Auto Parts Athens, GA J.C. Nash Truck Parts, Inc. 706-549-7914
J.C. Nash Truck Parts, Inc. offers professional and complete truck parts and auto parts to the Athens, GA area. Call 706-549-7914 today.
Truckpartsathensga.com  ~   Site Info   Whois   Trace Route   RBL Check  
baystatequicklane.com Truck Repair - Truck Service - Quick Lane Tire & Auto - Stoughton - Massachusetts
Call (781) 318-3259 . Quick Lane Tire & Auto Offers Truck Service & Truck Repair
Baystatequicklane.com  ~   Site Info   Whois   Trace Route   RBL Check  
b-btruckandauto.com Auto Part Sidney, OH - B & B Truck & Auto Parts 866-398-6038
B & B Truck & Auto Parts provides Truck and auto parts, Cash for wrecked and broken cars to Sidney, OH. Call 866-398-6038 Us Today for Quality Automotive Parts.
B-btruckandauto.com  ~   Site Info   Whois   Trace Route   RBL Check  
classictruckforsale.info Classic Trucks For Sale, Classic Chevy Truck, Ford Classic Trucks, Classic Pickup Trucks
Browse classic trucks for sale by popular brands like classic chevy trucks, ford classic trucks, custom classic truck, classic truck part, classic truck classifieds and various classic pickup trucks.
Classictruckforsale.info  ~   Site Info   Whois   Trace Route   RBL Check  
etrucktires.com Service Tire Truck Centers, Retread Commercial Truck Tires
Offers new and retread commercial truck tires in DE, MD, NJ, and PA including such brands as Kelly, Cooper, Michelin, and Goodyear.
Etrucktires.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: itrucktires.com - sttc.com - tirecasings.com
 


Page 301/616« Previous299300301302303Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com