turkey - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Turkey: 76,404 results found.

sidepropertyrentalsturkey.com Side Property Rentals Turkey
Side rentals in Turkey
Sidepropertyrentalsturkey.com  ~   Site Info   Whois   Trace Route   RBL Check  
chrystelrigaud.com Chrystel Rigaud
chrystelrigaud rigaud chrystel vietnam ireland mongolia turkey romania contact
Chrystelrigaud.com  ~   Site Info   Whois   Trace Route   RBL Check  
pcplus.com PC Plus Turkey - Wecome to PC Plus Turkey
pcplus snapnames turkey plus wecome tanıtım web ekibimiz profili iletişim toplu google şirket üyelik sorular ticaret bilgilendirme katılın sorulan bilgisayar satış sıkça bize siteleri adwords hizmetleri elektronik işlemleri eposta müşteri sözleşmesi ana tasarım ürün mail firma seo sayfa anasayfa techsell
Pcplus.com  ~   Site Info   Whois   Trace Route   RBL Check  
ephesushomes.net Turkey Homes for Sale | Homes inTurkey Kusadasi Villa Turkey Investment Property Bodrum Apartment
ephesushomes turkey kusadasi beach homes property gözden saat liveinternet son geçirmelerin için sayısı ziyaretçilerin villa bodrum investment apartment inturkey sale tdiv messages style document euroka writeln apartments second window whichdiv obj top=parseint parseint function getelementbyid countryside buying new startscroll rent
Ephesushomes.net  ~   Site Info   Whois   Trace Route   RBL Check  
charlescampbellprints.com Charles Campbell Prints
charlescampbellprints himes turkey holler prints campbell charles artist lewis county cabin old trough watering place hamlin creek copyright new original home online welcome artwork appalachian available print kentucky resident series
Charlescampbellprints.com  ~   Site Info   Whois   Trace Route   RBL Check  
turkeyfinancial.com Turkey Financial News
turkeyfinancial powered turkey financial news comments view posts analysis april turkish february economic report percent filed export markets sectoral january september investments march july indicators reports says posted textile billion october airlines year december august june telecoms import foreign fairs
Turkeyfinancial.com  ~   Site Info   Whois   Trace Route   RBL Check  
antalyaflights.com Antalya Flights
antalyaflights antalya flights turkey bookmark share admin airport posts politics comment alanya comments map view good beach weather point like need contour lines bus mens pharmacy geography destinations lara drugstore asked posted tagged thanks filed january anamur detailed clubbing help
Antalyaflights.com  ~   Site Info   Whois   Trace Route   RBL Check  
turkeycreekhoa.org Turkey Creek HOA
turkeycreekhoa turkey creek hoa crime door watch comments wallet stolen posts community safe salespeople safeguarding smart deterrent absence long questionnaire leaving uncategorized events news meeting board annual view wordpress link permanent february website closed april june home update feed crimewatch
Turkeycreekhoa.org  ~   Site Info   Whois   Trace Route   RBL Check  
turkeywows.com Turkey, wowcities.com
turkeywows sign turkey help popup close wowcities com page portal loading wow new group add settings cities description tab widget themeremove organize connect pages categoryedit categorydelete photosedit album friendedit themedelete balloon turn sec afrikaansalbanianarabicbelarusianbulgariancatalanchinese simplifiedchinese traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish language heading hover time
Turkeywows.com  ~   Site Info   Whois   Trace Route   RBL Check  
coastguideofturkey.com Coast Guide of Turkey
coastguideofturkey turkey guide coast kayıt ana neredeydik firma iletişim sayfa çelmen onat yelken dünyası mail basın listesine şartları yazısı kullanım tüm olarak bir bilgileri aktif mevki sisteme sistemde ile kıyı ilgili hale bilgiler yabancı olduğumuz bütün bitiminde çekim yaptığımız bulabileceklerdir
Coastguideofturkey.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 430/514« Previous428429430431432Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com