unto - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Unto: 7,010 results found.

irfc-nausena.gov.in Information Resource & Facilitation Centre, Indian Navy
Indian Navy - Information Resource & Facilitation Centre
Irfc-nausena.gov.in  ~   Site Info   Whois   Trace Route   RBL Check  
jeannepearce.com Promise Unlimited
Promise Unlimited is both a ministry and a braoadcast about bringing God's promises to people from His Word.
Jeannepearce.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: promiseunlimited.com - promiseunlimited.org
kevinwilliamslandscapedesign.com Lawn Cape Girardeau, MO - Williams Landscape Design 573-587-1714
Williams Landscape Design provides Commercial and residential, Landscape installation, Landscape maintenance to Cape Girardeau, MO. Call 573-587-1714
Kevinwilliamslandscapedesign.com  ~   Site Info   Whois   Trace Route   RBL Check  
nrrcc.org Home
Enter a brief description of your site here.
Nrrcc.org  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: cleaningservants.com
porticocafe.com Home
Musician
Porticocafe.com  ~   Site Info   Whois   Trace Route   RBL Check  
sonoita4square.org Sonoita Foursquare Church - Home
                               "...Behold, I say to you, lift up your eyes and look at the fields, for they are already white for harvest!"  John 4:35
Sonoita4square.org  ~   Site Info   Whois   Trace Route   RBL Check  
stainimaging.com Stain Imaging
Meta Description
Stainimaging.com  ~   Site Info   Whois   Trace Route   RBL Check  
stirfryvegetables.com Stir Fried Vegetables - Stir Fry Vegetables
Stir fry vegetables are a healthy and colorful addition to any meal, and often are a meal unto themselves. They are best-known for originating in Asian cuisine, being introduced to western culture along with Chinese and Japanese cooking decades ago, and with the popularity of other Asian foods now prevalent we see them in Thai and Vietnamese cuisine restaurants and cookbooks.
Stirfryvegetables.com  ~   Site Info   Whois   Trace Route   RBL Check  
thedaysofrevival.com Ene Time Revival
This web site has been created technology from Avanquest Publishing USA, Inc.
Thedaysofrevival.com  ~   Site Info   Whois   Trace Route   RBL Check  
theonlyhope.com The Only Hope - Cartoon tract ministry leads Catholics, Protestants and all religions to the truth.
The Only Hope - This cartoon tract ministry leads Catholics, Protestants and other religions to the mandatory truth. We have been taught what not to do rather than the two must do's. The Bottom Line.
Theonlyhope.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 124/393« Previous122123124125126Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com