uttar - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Uttar: 1,929 results found.

ratansoni.com Ratan Soni : A Silver Merchant of Ballia, Uttar Pradesh.
ratansoni hit tumblr counter com pradesh soni silver ratan uttar ballia designs designed singh anjoria www merchant rings cutlery jewellery contact nose details ear sales copyright email phones presented popular purvanchal provide market ganesh mahalaxmi jewellers hand local bangles pendants
Ratansoni.com  ~   Site Info   Whois   Trace Route   RBL Check  
wowlucknow.com Lucknow, Uttar Pradesh, India, wowcities.com
wowlucknow sign help close popup lucknow india uttar pradesh wowcities com page portal loading wow new add group cities settings layoutedit description widget categoryedit categorydelete tab groupedit keyworddelete connect privilegesadd icondelete organize pages albummanage album simplifiedchinese afrikaansalbanianarabicbelarusianbulgariancatalanchinese relating shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish
Wowlucknow.com  ~   Site Info   Whois   Trace Route   RBL Check  
craftsutra.com Craft Sutra
indian stone carving, uttar pradesh stone carvers, stone crafts,asia,india,sandstone,stone,stone carving,uttar pradesh,making a maypole, decorating a maypole, kids maypole, english maypoles,england,european folk traditions,kids,maypole,regional traditions,chikankari,cotton,embroidery,fabrics,lucknow,karnataka sandalwood carving, about sandalwood, indian wood crafting,carving,karnataka,sandalwood,wood,mashru weaving, gujarati mashru weaving, cotton and silk weaving in india,gujarat,mashru,silk,weaving,kantha embroidery, kantha embroidery of bengal, indian craft, kantha work,kantha,west bengal
Craftsutra.com  ~   Site Info   Whois   Trace Route   RBL Check  
uptta.com Uttar Pradesh Table Tennis Association-UPTTA
uptta table tennis association pradesh uttar read sitemap home asian championships contact history list bearers office gallery champions ranking best award ttfi infrastrucute chinta mukti nkg pewer nittaku attu grid esic stag zoola annual attc advertising results goldmine lucknow city
Uptta.com  ~   Site Info   Whois   Trace Route   RBL Check  
unicefup.org Welcome to UNICEF Office for Uttar Pradesh Online
unicefup unicef uttar pradesh office online welcome use personal password know contact ids focal forgotten email log point experience field coordinators associated exclusive intended org mail issued access section lucknow make technology communication step information life simple used service new
Unicefup.org  ~   Site Info   Whois   Trace Route   RBL Check  
esicuttarpradesh.org ::Welcome to ESIC Uttar Pradesh Region, Kanpur::
esicuttarpradesh home calender search region esic uttar pradesh welcome kanpur info recruitment benefits public list glance ssmc administrative scheme result act centres tender contact hospital advt phone information legal cell right notifications directory judgements feedback introdution notice empanelled branches dispenseries
Esicuttarpradesh.org  ~   Site Info   Whois   Trace Route   RBL Check  
apavayan.com 8/320 Indira Nagar, Lucknow,Uttar Pradesh, India
www.Apavayan.com
Apavayan.com  ~   Site Info   Whois   Trace Route   RBL Check  
ashagroupofinstitutions.com Asha Classes faizabad Uttar Pradesh India
IIT,JEE,2009,iit,jee,iit-jee,solutions,answers,Institute for iit,Faizabad coaching India, IIT Classes,Asha Classes, JEE Coaching,JEE Preparation, IIT JEE Coaching, coaching institutes in india, coaching institutes in lucknow, iit coaching classes, iit entrance coaching, iit coaching in faizabad, iit jee coaching in kota, iit kota.
Ashagroupofinstitutions.com  ~   Site Info   Whois   Trace Route   RBL Check  
ghaziabadup.com Ghaziabad UP- Information about Ghaziabad Uttar Pradesh
ghaziabadup piles ghaziabad information uttar pradesh factory dealers computer service site web consultant law cyber adviser product home estate east cinema malls broker stockists share colleges doctors hotels nursing associates industrial schools placement hospitals industry ngo developer mobile dealer software
Ghaziabadup.com  ~   Site Info   Whois   Trace Route   RBL Check  
hakim-ji.com H. A. HAKIM JI & SONS
hakim sons ji india phones fax uttar bazar bareilly cantt pradesh
Hakim-ji.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 74/126« Previous7273747576Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com