waco - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Waco: 6,731 results found.

weddingsympathyflorist.com Flower Delivery, Main West, TX - Divine Designs, 254-826-8114
Divine Designs provides Gift, Bling jewelry to Main West, TX. Call 254-826-8114 for all your floral arrangement needs.
Weddingsympathyflorist.com  ~   Site Info   Whois   Trace Route   RBL Check  
zombiewesternmusic.com The End...And The Aftermath, by Zombie Western
6 track album
Zombiewesternmusic.com  ~   Site Info   Whois   Trace Route   RBL Check  
angelhealthcare.net Private Health Care .:. Angel Healthcare
Angel Healthcare is Austin's Best Private Duty Home Health Care Agency. We have private duty home health care locations in Austin, San Antonio, Dallas, Houston, Waco, Wimberley, Temple, Killeen.
Angelhealthcare.net  ~   Site Info   Whois   Trace Route   RBL Check  
barjonamusic.com BARJONA
BARJONA MUSIC STORE
Barjonamusic.com  ~   Site Info   Whois   Trace Route   RBL Check  
barrierislandaviation.com Outer Banks Scenic Air Tours
We serve the Outer Banks and eastern NC with a wide array of aviation services including air charters, scenic air tours, flight instruction, aircraft rental & aircraft maintenance.
Barrierislandaviation.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: obxairplanerides.com - obxairplanetours.com - obxbiplanetours.com
bostonsoftexas.com Boston Terriers of Texas
Boston Terriers of Texas is the source for your new boston terrier puppy.
Bostonsoftexas.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: bostonterrierpuppiesforsaleintexas.com - bostonterriersoftexas.com
chimneyandwildlifespecialist.com Dallas Chimney Sweep - DFW Cleaning - Home
Dallas Chimney and Wildlife Specialist offers chimney sweep service, chimney cleaning, chimney caps and wildlife attic removal in Dallas and DFW, including skunks and raccoons.
Chimneyandwildlifespecialist.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: dallaschimneywildlife.com
conch-air.com Biplane rides in the Florida Keys
Experience the exhiliration of open flight over the fabulous Florida Keys
Conch-air.com  ~   Site Info   Whois   Trace Route   RBL Check  
continental-cargo.com index 
CONTINENTAL CARGO, Forrest River, CARDINAL-SALES 765-529-2677, ALUMINUM FRAME CAR HAULER, Cargo Trailers Indiana, C argo Trailers Dallas Oregon, Cargo Trailers Waco Texas
Continental-cargo.com  ~   Site Info   Whois   Trace Route   RBL Check  
crocslawsuitsinfo.com Croc Lawsuits – Free Legal Advice, Act Now
Crocs shoes have caught the fancy of children world over with the bright color designs and flexible feet hugging designs. Crocs shoes are made of rubb
Crocslawsuitsinfo.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 216/407« Previous214215216217218Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com