waitrose - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Waitrose: 745 results found.

limepickle.net Untitled Document
limepickle untitled document lemonsoap argos gala penn konzum jessops neumann bbc tesco aga net sap coke joes hok rawls ready chapelfield kaleidoscope case portfolio blog nicu jempsons pricenews union brew currys pcs plymouth chance kascope pulse xmas waitrose perelman coldharbour
Limepickle.net  ~   Site Info   Whois   Trace Route   RBL Check  
designfidelity.com London website design | Design Fidelity | Welcome
designfidelity design fidelity website london welcome page follow work new facebook click twitter html content examples skip touch main clients email add address opens browser window check creative contact news websites newsletters print good waitrose faq reasons updates testimonials home
Designfidelity.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: designfidelity.co.uk
guypatrick.com Guy Patrick
guypatrick divider patrick guy logo minds projects contact university hand story work otoysruswaitroseabel wateraidtoyotacrisisp busbunnings concertstournament coleneilsonflanders hardwarelicktraveleasytransperth letteringsunglassesscribbles tourismsmartrider tvcurtin traveleasy bunnings lick hardware transperth lettering bus scribbles sunglasses tournament concerts toyota waitrose toysrus crisis wateraid abel cole smartrider
Guypatrick.com  ~   Site Info   Whois   Trace Route   RBL Check  
cheshiremums.com Cheshire Mums Magazine - Home
birth, cheshire, baby, mums, natural, cheshire mums
Cheshiremums.com  ~   Site Info   Whois   Trace Route   RBL Check  
orpingtonfc.org.uk Orpington Football Club
orpingtonfc football club orpington news soccer school read home welcome league bromley final trophy easter kent association closed holidays teams foundation view posts win chairman reach year links tandoori gate waitrose raj contact visitors filed website youth park community match
Orpingtonfc.org.uk  ~   Site Info   Whois   Trace Route   RBL Check  
managedrisksolutions.co.uk Managed Risk Solutions Ltd - Welcome to MRSL
managedrisksolutions mrsl risk solutions managed welcome page shortcut home key= profits rise service obama new pensions greece create waitrose contact books davidson online package chief tesco jobs worries harley goldman ramps asian profit agreed weak growth quarterly intel jump ruled
Managedrisksolutions.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
stamfordskatepark.co.uk Stamford Skatepark | Stamford Skatepark
stamfordskatepark welcome stamford skatepark design skateboarders draft scourge society http www news good maverick article industries people coin general waitrose young thingy living green engineering gravity riverside festival total wotsit shock skate update aren causes facilities lack proceeds collection shocker
Stamfordskatepark.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
brightonpalestine.org Brighton Jordan Valley Solidarity | ...building grassroots solidarity between communties in the Jordan Valley in Palestine and Brighton in the UK
brightonpalestine valley brighton jordan solidarity syndicate content palestine home grassroots building drupal powered xhtml valid strict communties page april farisiya tubas settlement waitrose israeli delegation dead situation search sea occupation supermarket produce stall report shut created critical rahma haaretz abu
Brightonpalestine.org  ~   Site Info   Whois   Trace Route   RBL Check  
yumchocolate.co.uk yum chocolate
yum,chocolate,yumchocolate,literary bites,literarybites,literary bites,dulwich,exclusive,gift,handmade,chocolates,chokoayumchokoa,chokoa yum chokoa
Yumchocolate.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
dovecotepark.com Dovecote Park | Home
dovecotepark dovecote park home welcome events links jobs calendar contact login producer news spacecreative www yorkshire waitrose partnership facilities complete maturation whilst plant slaughter highest west stapleton processing beef dedicated north beliefs culture customers associates creative encompassing values plants processed
Dovecotepark.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 28/36« Previous2627282930Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com