waitsfield - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Waitsfield: 306 results found.

waitsfieldinn.com Waitsfield Inn
Historic bed and breakfast lodging in Vermont's beautiful Mad River Valley near Sugarbush and Mad River Glen. View our accommodations and learn about exciting activities in our Valley and surrounding areas.
Waitsfieldinn.com  ~   Site Info   Whois   Trace Route   RBL Check  
496laundry.com The Waitsfield Laundromat
The Waitsfield Laundromat Home Page.
496laundry.com  ~   Site Info   Whois   Trace Route   RBL Check  
waitsfieldchildrenscenter.org WCC - Waitsfield Children's Center
Waitsfield Children's Center
Waitsfieldchildrenscenter.org  ~   Site Info   Whois   Trace Route   RBL Check  
themadtaco.com The Mad Taco - Waitsfield, VT: Home
The Mad River Valley's premier taqueria.
Themadtaco.com  ~   Site Info   Whois   Trace Route   RBL Check  
waitsfieldpottery.com Welcome to Waitsfield Pottery
Handmade stoneware pottery from Waitsfield Vermont in the Sugarbush Mad River Valley
Waitsfieldpottery.com  ~   Site Info   Whois   Trace Route   RBL Check  
vtcollection.com The Collection - Waitsfield Vermont - At Mad River Green Shopping Center
The Collection in Waitsfield, Vermont is home of The Valley's Premier Gift Shop, Mad River Interior Design and The Valley Toy Store.
Vtcollection.com  ~   Site Info   Whois   Trace Route   RBL Check  
waitsfieldwine.com Waitsfield Wine Shoppe, Waitsfield Vermont highway 100 in Mad River Valley
Waitsfield Wine Shoppe, Mad River Valley, Vermont for Specialty Wines for Weddings and all occasions.
Waitsfieldwine.com  ~   Site Info   Whois   Trace Route   RBL Check  
madriverphonebook.com Waitsfield Telecom Mad River Valley Vermont Phone Book and Online Directory
The Waitsfield Telecom Directory is distributed to all homes and businesses in the Mad River Valley and includes the towns of Waitsfield, Warren, Moretown, and Fayston
Madriverphonebook.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: madriverphonebook.net
waitsfieldchamplainvalleytelecom.com Waitsfield and Champlain Valley Telecom
Waitsfield and Champlain Valley Telecom is your truly local telephone company serving the Mad River and Champlain Valley regions of Vermont with local telephone, high-speed DSL Internet, and long distance services.
Waitsfieldchamplainvalleytelecom.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: waitsfieldchamplainvalleytelecom.net - waitsfieldtel.com - waitsfieldtelecom.net - waitsfieldtel.net - wcvt.com
vtvegcar.com Vermont Veg Car - Vegetable Oil Conversions and Full Service Auto Repair
A full service auto repair garage in Barre, Vermont that specializes in VW automobiles and vegetable oil conversions for all types of diesel engines.
Vtvegcar.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 1/21« Previous12345Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com