walkways - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Walkways: 8,113 results found.

gwawning.com Home
home
Gwawning.com  ~   Site Info   Whois   Trace Route   RBL Check  
hleng.co.uk Home - HL Engineering Contractors Ltd
A familiy run engineering company that has advanced in the design and manufacture of walkways, platforms and structures. We can provide maintenance staff for on site duties for day to day plant works.
Hleng.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
hpi-corporate.com Homecare Products, Inc.
Homecare Products, Inc. specializes in manufacturing and distributing products that help people with access and mobility challenges enjoy life beyond the barriers and achieve their full potential.
Hpi-corporate.com  ~   Site Info   Whois   Trace Route   RBL Check  
ilclandscape.com - Overview
Iannace Landscaping Contracting
Ilclandscape.com  ~   Site Info   Whois   Trace Route   RBL Check  
independentstoneworks.com Independent stoneworks serving Western North Carolina's stone mason needs
Independent stoneworks is a commercial and residential stonemason contractor who provides natural or manufactured stone mason services including stone fireplaces, stone veneer, flagstone walkways, steps, patios, and columns for new construction, restoration, and landscape related stonework
Independentstoneworks.com  ~   Site Info   Whois   Trace Route   RBL Check  
jgwmasonry.com JGW MASONRY - FOR ALL YOUR HARDSCAPE PROJECTS
full service masonry contractor. specializing in the installation of concrete pavers
Jgwmasonry.com  ~   Site Info   Whois   Trace Route   RBL Check  
jterotech.com - J.Terotech LTD, The turnkey approach to weather-proofing – Fife, Scotland.
The turnkey approach to weather-proofing and refurbishment
Jterotech.com  ~   Site Info   Whois   Trace Route   RBL Check  
leonelandscape.com Leone Landscape & Construction Newton MA - Landscape & Stone Contractors Massachusetts
Landscape & Construction - Leone Landscape & Construction Newton MA - Landscape & Stone Contractors
Leonelandscape.com  ~   Site Info   Whois   Trace Route   RBL Check  
longislandeliteinc.com Long Island Landscape Contractor - Long Island, NY - Landscaping - Suffolk County Landscape Contractors
Long Island Elite Landscape Design specializes in all types of masonry and landscape design and construction. Serving the Long Island, New York area since 1980.
Longislandeliteinc.com  ~   Site Info   Whois   Trace Route   RBL Check  
maineisokernfireplaceandchimneydealer.com Somerset Stone Center & Excavation - Maine Isokern Fireplace and Chimney Systems
Maine Isokern Fireplace and Chimney Dealer - Modular masonry fireplace and chimney systems manufactured from volcanic pumice. Interior and Exterior fireplace systems.
Maineisokernfireplaceandchimneydealer.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 160/562« Previous158159160161162Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com