waller - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Waller: 2,616 results found.

enontab.org Welcome to The Enon Tabernacle Baptist Church Web Site.
Enon Tabernacle Baptist Church, A Place Where People Encounter God. - Senior Pastor Reverend Dr. Alyn E. Waller
Enontab.org  ~   Site Info   Whois   Trace Route   RBL Check  
llledbetterlaw.net Home
Lisa Ledbetter Brandon Lawyer, Brandon Florida Attorney
Llledbetterlaw.net  ~   Site Info   Whois   Trace Route   RBL Check  
formation-meltis.fr Formations, management, RH & team building : l'actu ! « Le blog de Meltis, la formation qui donne envie !
Le blog de Meltis, la formation qui donne envie !
Formation-meltis.fr  ~   Site Info   Whois   Trace Route   RBL Check  
stevenhwaller.com index
Steven H Waller heartfelt sentiments to your child
Stevenhwaller.com  ~   Site Info   Whois   Trace Route   RBL Check  
beverlyhillsdivorcelawyersite.com Home Page
Certified Family Law Specialist. Offices in Calabasas and Beverly Hills. Results-oriented divorce lawyers. 1-800-655-4766. Children's best interests always in mind.
Beverlyhillsdivorcelawyersite.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: feinbergwaller.com - losangelescertifiedfamilylawspecialist.com - losangelesdivorceattorneynow.com - losangelesdivorceattorneytoday.com - losangelesdivorcelawyertoday.com - losangelesdivorcesite.com - losangelesdivorcetoday.com - mybeverlyhillsdivorceattorney.com - mysanfernandovalleydivorcelawyer.com - sanfernandovalleydivorceattorneysite.com - sanfernandovalleydivorcelawyersite.com - santamonicadivorceattorneytoday.com - thebeverlyhillsdivorceattorney.com - thebeverlyhillsdivorcelawyer.com - thelosangelesdivorceattorney.com - thelosangelesdivorce.com - thelosangelesdivorcelawyer.com - thesanfernandovalleydivorceattorney.com - thesanfernandovalleydivorcelawyer.com - thesantamonicadivorceattorney.com - thewestlosangelesdivorceattorney.com - thewestsidelosangelesdivorceattorney.com - thewestsidelosangelesdivorcelawyer.com - westlosangelesdivorceattorney.com - westlosangelesdivorceattorneysite.com - westsidelosangelesdivorceattorney.com - westsidelosangelesdivorceattorneysite.com - westsidelosangelesdivorcelawyer.com - westsidelosangelesdivorcelawyernow.com
ajemdesign.com AJEM Home Design & Remodeling | Bathroom Remodeling, Decks, Patios, Kitchen,- Houston, Spring, Cypress, Tomball, Magnolia, Hockley and Waller areas
AJEM Home Design and Remodeling - An inovative home remodeler and general contractor serving Houston, Spring, Cypress, Tomball, Magnolia, Hockley, Waller - Texas
Ajemdesign.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: ajemdesigns.com - remodelingspringtx.com
laurajeanbell.com Marriage | Relationships | Couples | Counselor | Therapist | Therapy | Counseling | The Woodlands | Spring | Montgomery | Magnolia | Conroe | Waller | Tomball | Houston | TX | Texas
Lauara Jean Bell provides marriage, relationship, and couples therapy and counseling in and around The Woodlands | Spring | Montgomery | Magnolia | Conroe | Waller |  Houston | TX | Texas
Laurajeanbell.com  ~   Site Info   Whois   Trace Route   RBL Check  
steveelder.com SteveElder Home Page
Steve Elder land sale Waller county, Texas.
Steveelder.com  ~   Site Info   Whois   Trace Route   RBL Check  
wallerangeln.com Willkommen im Wallercamp Serravalle, Wallerfischen, Wallerangeln im Po-Delta
Fotos und Informationen über Wallerangeln im Po-Delta im Wallercamp Serravalle.Wir heißen sie herzlich willkommen zum Wallerfischen im Po-Delta
Wallerangeln.com  ~   Site Info   Whois   Trace Route   RBL Check  
wallercountysites.org Waller County Prospector: Economic Development Available sites, buildings, demographics, businesses and GIS mapping---
Search for available commercial, industrial, office, retail or warehouse properties. Make informed site selection decisions by generating site-specific reports on demographics, workforce, competitors and consumer spending.
Wallercountysites.org  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 36/154« Previous3435363738Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com