waller - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Waller: 2,616 results found.

treesongstudio.com Karen Kluge Waller
Karen Kluge Waller
Treesongstudio.com  ~   Site Info   Whois   Trace Route   RBL Check  
joewallerdesign.com The Design Portfolio of Joe Waller
The Design Portfolio of Joe Waller
Joewallerdesign.com  ~   Site Info   Whois   Trace Route   RBL Check  
losangelescustody.com LOS ANGELES CUSTODY
Los Angeles Custody
Losangelescustody.com  ~   Site Info   Whois   Trace Route   RBL Check  
losangelesdivorcelawyersite.com LOS ANGELES DIVORCE LAWYER
Los Angeles divorce lawyer
Losangelesdivorcelawyersite.com  ~   Site Info   Whois   Trace Route   RBL Check  
wallerhallresearch.com Waller Hall Research, LLC
Waller Hall Research Center offers qualitative, quantitative analysis, focus groups, in depth interviews, opinion research, surveys and data collection.
Wallerhallresearch.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: wyomingcallcenter.com
bigjohnpropanegas.com Propane Tank Service | RV Repair - Waller, TX
Big John Propane Gas & Fuel Distributors offers emergency mobile service for gas propane systems of establishments and vehicles in Waller, TX. Call 281-702-1904 for details.
Bigjohnpropanegas.com  ~   Site Info   Whois   Trace Route   RBL Check  
wallercountyland.com Waller County Land Company
Residential - Farms - Ranches - Acreage - Waller, Northwest Houston and Harris Counties.
Wallercountyland.com  ~   Site Info   Whois   Trace Route   RBL Check  
waller-angeln.com Angeln in Spanien Teil 2 - Welsangeln
Angeln in Spanien für Ihren erfolgreichen Welsfang. Freude am Waller Wels Catfish Fang.
Waller-angeln.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: wels-angeln.com
skyfairchildwaller.com Sky Fairchild-Waller
Sky Fairchild-Waller is an American-Canadian artist currently based in Toronto. He attended the Nat
Skyfairchildwaller.com  ~   Site Info   Whois   Trace Route   RBL Check  
calabasascertifiedfamilylawspecialist.com CALABASAS CERTIFIED FAMILY LAW SPECIALIST
Calabasas Certified Family Law Specialist
Calabasascertifiedfamilylawspecialist.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 9/154« Previous7891011Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com