wanderings - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Wanderings: 656 results found.

kimberleygriffithslittle.com Kimberley Griffiths Little
kimberleygriffithslittle kimberley little griffiths book spell healing kite crystal guide monday spellbinders teacher wanderings award scholastic runner fair books author mother daughter download club new whitney finalists season longer pdf bio free swank web style livejournal facebook blog amazon coming
Kimberleygriffithslittle.com  ~   Site Info   Whois   Trace Route   RBL Check  
ouritaliantable.com Our Italian Table
ouritaliantable table italian construction comwebsite coming soon com michele email wordpress blog wine food wanderings beloved home italy visit
Ouritaliantable.com  ~   Site Info   Whois   Trace Route   RBL Check  
suriestudios.com Surie Studios (Home)
suriestudios surie home firedance studios contact people spaces copyright site used images written way permission opening big small wanderings having trouble galleries flash click
Suriestudios.com  ~   Site Info   Whois   Trace Route   RBL Check  
artshotsphotography.com Photographs of wild places, flora and fauna, friends, adventures, and graphic design. Winthrop, Washington in the beautiful Methow Valley is where I call home, my wanderings are in the North Cascades. This website is compiled with some of the layers in my life. Take a look, send me an email, and check back often. | Art Shots | Sally Ranzau
artshotsphotography design tundra pine forest vistas publish feathers lone bio links contact sally winthrop home graphic ranzau dark smooth check art shots photographs email beautiful washington methow valley wanderings adventures friends wild places flora fauna north cascades compiled send layers
Artshotsphotography.com  ~   Site Info   Whois   Trace Route   RBL Check  
sallyranzau.com Photographs of wild places, flora and fauna, friends, adventures, and graphic design. Winthrop, Washington in the beautiful Methow Valley is where I call home, my wanderings are in the North Cascades. This website is compiled with some of the layers in my life. Take a look, send me an email, and check back often. | Art Shots | Sally Ranzau
sallyranzau design tundra pine forest vistas publish feathers lone bio links contact sally winthrop home graphic ranzau dark smooth check art shots photographs email beautiful washington methow valley wanderings adventures friends wild places flora fauna north cascades compiled send layers
Sallyranzau.com  ~   Site Info   Whois   Trace Route   RBL Check  
bshep.com shep's shed ~ home
bshep setstats home shed shep http com blog active snowdonia www wainwright site meadowview sheps callunapics org stridingedge wanderings net miscellany corner weddings pet way parties tour photo album snowdon new link lots photography heather thanks click sites visit info
Bshep.com  ~   Site Info   Whois   Trace Route   RBL Check  
caridiangroup.com Caridian Press
caridiangroup caridian press book contact series order updates news publications jim home scott wanderings sojourns seven time related samples links sites fires rss facebook form www funkyspider sk=group php http com march group atom comments november rsd sam feed company
Caridiangroup.com  ~   Site Info   Whois   Trace Route   RBL Check  
ekeretallie.com The work of Ekere Tallie
ekeretallie stats plugin wordpress free work website tracker tallie ekere nature honey sage com mother motherhood journey pregnancy candid account writing stories travel poetry essays wanderings mind medicine plant world blog booklet
Ekeretallie.com  ~   Site Info   Whois   Trace Route   RBL Check  
qr5.org qr5 Photography
qr5 photography scenic flash macromedia com place night day spring illegal ice invasions matthew time view gallery click drafttattoo privacy wanderings requires links rights prints want themes dayplacewanderingspringicetimeinvasionsillegal reserved musicmatthewmaaskant maaskant colorsthis commusic maaskantall installed summerscenicnight productionwww simpleviewer startwintertemporary images
Qr5.org  ~   Site Info   Whois   Trace Route   RBL Check  
tatejakes.com Tate Jakes
tatejakes tate jakes rant possibly wanderings site contact century com ponderings web favourites ideas poems writing home philosophies miscellany writings miscellaneous place musings
Tatejakes.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 34/45« Previous3233343536Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com