warsaw - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Warsaw: 6,512 results found.

ffoofwarsaw.com Furniture Factory Outlet of Warsaw
ffoofwarsaw furniture factory warsaw outlet mattress simmons angry face logo image featured filed posts view wood crest beds symbol klaussner rugs coaster catnapper riveside jackson serta shaw home specials contact ashley brandsashley reserved rights copyright rss atom
Ffoofwarsaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
fellowship-warsaw.org FellowshipWarsaw
fellowshipwarsaw fellowship church baptist warsaw interior home weekly click sign contact sermons staff events crossseekers ccf god gather worshipat mapor come soon need sundayjoin directions kosciusko dropping drive indiana east december page updated friday week christ develop deep relationships learning
Fellowship-warsaw.org  ~   Site Info   Whois   Trace Route   RBL Check  
wowwarsaw.com Warsaw, Warszawa, Poland, wowcities.com
wowwarsaw sign help popup close warsaw poland warszawa wowcities com page portal loading wow new add group settings cities categoryedit tab layoutedit widget groupedit categorydelete description pages icondelete privilegesadd albummanage organize album connect keyworddelete share hover shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish network time
Wowwarsaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
datacenter-warsaw.net Telehouse.Poland collocation center
datacenter poland telehouse warsaw collocation center cisco dell juniper emerson sun services contact colocation carriers characteristics list form telco data ring thp specifications photo highlights news references assets gallery technical calculator download work files view degree conditions usage telecommunications lines
Datacenter-warsaw.net  ~   Site Info   Whois   Trace Route   RBL Check  
trinitywarsawny.org Welcome to Trinity Episcopal Church in Warsaw, NY
Trinity, Episcopal, Church, Warsaw, Religion
Trinitywarsawny.org  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: trinitywarsaw.org
warsawadventist.org Warsaw Seventh-day Adventist Church
warsawadventist church warsaw day seventh adventist online conference bible discover hope facts amazing prophecy voice written abn mission adra statement map believe indiana union lake world free guides requests quarterly prayer box east phone email
Warsawadventist.org  ~   Site Info   Whois   Trace Route   RBL Check  
comptroubnei.com Computer Repair in Warsaw, IN | Computer Repair & Managed IT Services Warsaw | Computer Troubleshooters Warsaw
comptroubnei computer warsaw troubleshooters repair west wayne services managed
Comptroubnei.com  ~   Site Info   Whois   Trace Route   RBL Check  
piwna.com Piwna Pages - Warsaw's Old Town
piwna information studies webmail polish warsaw town pages old photo boratyńska content contact libraries photos living starówka news archives bookstores
Piwna.com  ~   Site Info   Whois   Trace Route   RBL Check  
consignmentboutiquestore.com Consignment Boutique Store Warsaw, Indiana
consignmentboutiquestore boutique consignment store warsaw indiana print twitter article facebook scaled safesubscribe exchange blog july designer prices clothes home topic goods com night added worth buckle location hosting web fan twas theme wordpress consigning school talbots panic galore taylor ann
Consignmentboutiquestore.com  ~   Site Info   Whois   Trace Route   RBL Check  
bristolwarsaw.com Hotel Bristol Warsaw, Poland
bristolwarsaw bristol hotel warsaw poland city old second easily suite best world attempting finest charming light choose gel effortlessly rooms treat tastes jet satisfy paderewski restorations balconies elegant golden days stay today halls age setting bumping modern buzz enjoyed figureheads
Bristolwarsaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 233/411« Previous231232233234235Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com