washer - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Washer: 18,807 results found.

beledup.com LED|RGB Controller|LED china|LED Lights, Bulbs, and Accessories
TheLEDup.Com stocks a variety of low voltage LED lighting products such as under cabinet lighting, LED bulbs, LED fixtures, flexible LED strips, LEDs by the piece, LED drivers, LED dimmers and power supplies, RGB color changing LED lights, Channel Letter LED Modules, led floodlights, led emergency lighting and lanterns, UV-Ultra Violet LED flashlights, LED desk lamps, LED bed reading lights, led Traffic Batons for crowd and vehicle control, LED motion sensing lights, led booklights, and many other LED products. TLLC is a full LED product line store.
Beledup.com  ~   Site Info   Whois   Trace Route   RBL Check  
bronxappliancerepair.com Queens, Bronx and Brooklyn Appliance Repair, Washer Repair, Dryer Repair, Appliance Repair Queens, Bronx and Brooklyn County
Quality Queens, Bronx and Brooklyn Appliance Repair Service, Queens, Bronx and Brooklyn Dryer Repair, Washer Repair, #1 Appliance Repair in Queens, Bronx and Brooklyn. Repairing washers, dryers, stoves, ovens, microwaves,dishwashers, refridgerators, disposals.
Bronxappliancerepair.com  ~   Site Info   Whois   Trace Route   RBL Check  
frontloadwashingmachines.org Front Load Washing Machines - Front Load Washing Machines
Front-loading washing machines clean better, are much more efficient and use less water than their top-loading countparts.
Frontloadwashingmachines.org  ~   Site Info   Whois   Trace Route   RBL Check  
historycleaner.com History Cleaner, free, download, Window washer, Evidence eliminator, internet eraser, absolute cookie cache windows cookies pro, cache, index.dat
History Cleaner, free download Window washer Evidence eliminator internet eraser absolute cookie cache windows cookies pro serials appz download supercool evidence eliminator, cache, index.dat
Historycleaner.com  ~   Site Info   Whois   Trace Route   RBL Check  
madenoracing.com Madeno Racing
Madeno Racing Suspension Technology
Madenoracing.com  ~   Site Info   Whois   Trace Route   RBL Check  
union-powers.com Downlight|LED Ceiling Lamp|LED Flood Light|LED Wall Washer Light|LED Strip-Union-powers OPTO CO., LTD.
“Founded
Union-powers.com  ~   Site Info   Whois   Trace Route   RBL Check  
belimed.us Belimed USA - Infection Control, Sterilization Products
As a world leader in infection control, specializing in cleaning, disinfection and sterilization, Belimed has been providing state-of-the-art products in the healthcare, pharmaceutical and laborat ory sectors worldwide for over 30 years.
Belimed.us  ~   Site Info   Whois   Trace Route   RBL Check  
washerdryerrepairfayetteville.com Mecklenburg County Appliance Repair, Refrigerator Repair Davidson County, Washer Repair Charlotte, Dryer Repair Charlotte, Dishwasher Repair Charlotte
Appliance Repair Service serving Mecklenburg, Davidson, Forsyth, Guilford, Alamance, Randolph, Cabarrus, Catawba and Rowan Counties including Washer, Dryer, Refrigerator, Oven and Dishwasher Repair Services.
Washerdryerrepairfayetteville.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: amblerappliancerepair.com - appliancerepairabington.com - appliancerepairfairfaxva.com - philadelphiaappliancerepaircompany.com
buy-appliance-parts.com Buy Appliance Parts - Appliance Parts
Looking for appliance parts to repair your stove, dishwasher or dryer? Quick and easy way to get the appliance parts you need delivered right to your front door.
Buy-appliance-parts.com  ~   Site Info   Whois   Trace Route   RBL Check  
fccleaningsystems.co.uk Pressure Washers, Steam Cleaners, Scrubber Driers or Scrubber Dryers, Floor Cleaners, Commercial Vacuums, Steam Vacs - Sales Repairs and Service
Professional and domestic pressure washers, high-pressure cleaners and steam cleaners by Nilfisk Alto Neptune, Karcher, Dual. Devon, Cornwall, Somerset, Dorset, Bristol Powerwash, BPS. Wet and dry vacuum cleaners, floor cleaners sweepers, scrubber dryers, ride-on scrubber driers, floor scrubber driers, polishers, sweepers, floorcare, brush machines, commercial vacuums and steam cleaning machines
Fccleaningsystems.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 163/570« Previous161162163164165Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com