westlake - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Westlake: 9,587 results found.

kitchensofwestlake.com Kitchens by Design Gallerie, LLC - Robin Denker - Westlake Kitchen and Bath Design, Westlake Cabinets
Conejo Valley's Kitchen Showroom. We deliver the cabinetry you want with beauty, style, function, infinite design possibilities and of course - value.
Kitchensofwestlake.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: robindenker.com
med-rest.com Mediterraneo - A Zagat Rated Restaurant in Westlake Village, CA :: Home
Mediterraneo is a top Zagat Rated restaurant located in Westlake Village, CA, on the grounds of the beautiful Westlake Village Inn. Mediterraneo also shares the property with the popular nightclub Bogie's.
Med-rest.com  ~   Site Info   Whois   Trace Route   RBL Check  
rickgaviati.com Simi Valley Real Estate - Westlake Village Real Estate
View featured listings, local school and city information for Simi Valley. Find out the latest buying and selling tips for Westlake Village Real Estate.
Rickgaviati.com  ~   Site Info   Whois   Trace Route   RBL Check  
puchers.com Cleveland Decorating - Berea, Westlake, North Royalton
Pucher's Decorating Centers - Serving the Cleveland area, Berea, Westlake & North Royalton for over 80 years.
Puchers.com  ~   Site Info   Whois   Trace Route   RBL Check  
redeemerchurch.com Redeemer Church
Redeemer Church
Redeemerchurch.com  ~   Site Info   Whois   Trace Route   RBL Check  
eight20photography.com Eight20 Photography | Westlake Village Wedding Photographer
eight20 photography is a combination of all their inspirations. their life. their love. their art. and they can't wait to capture yours.
Eight20photography.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: eight20photographyblog.com - eighty20photography.com
2200condo.com 2200 Condo ~ 2200 Westlake ~ Seattle Condos :: 425-269-3445 :: Bellevue, WA :: Welcome
Beautiful condo at 2200, This luxurious condo at 2200 features spectacular views! Seattle condominiums, don't miss this one!
2200condo.com  ~   Site Info   Whois   Trace Route   RBL Check  
westlakeheatingandair.com Westlake Heating and Air Conditioning
Westlake Heating & Air Conditioning, Inc. was established in 2004. We are a group of professionals who have been in the heating and air conditioning business with a combined total of over 100 years experience. We service and install not just at Smith Mountain Lake, but the entire Roanoke Valley and surrounding areas.
Westlakeheatingandair.com  ~   Site Info   Whois   Trace Route   RBL Check  
westlakevillagefamilyservices.com Westlake Village Thousand Oaks individual couple family group therapy
Westlake Village Family Services Michael Kaufman, M.F.T., Psy.D. provides counseling and therapy services in and around ...
Westlakevillagefamilyservices.com  ~   Site Info   Whois   Trace Route   RBL Check  
swordfurs.com Leather and Fur Accessories Westlake, OH ( Ohio ) - Sword Furs - Home
Sword Furs of Westlake, OH is a full service furrier offering a large selection of new and preowned furs and fur repairs and restyling. 440-249-4355.
Swordfurs.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 48/519« Previous4647484950Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com