wheel - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Wheel: 82,626 results found.

raleighwheelrepair.com Auto Recon Pros > Alloy Wheel Repair and Reconditioning
Alloy wheel repair, reconditioning and sales in Raleigh, NC
Raleighwheelrepair.com  ~   Site Info   Whois   Trace Route   RBL Check  
fifthwheelrvdealer.com Fifth Wheel RV Dealer - , Forest River RVs, RV Sales, The Original RVWholesalers, fifthwheelrvdealer.com
Fifth Wheel RV Dealer, , Forest River RVs, RV Wholesalers offers RVs for sale, travel trailers, toy haulers, RV parts, RV accessories, used RV sales & fifth wheel campers at the best prices. International Forest River RVs with excellent customer service. 1-877-877-4494.
Fifthwheelrvdealer.com  ~   Site Info   Whois   Trace Route   RBL Check  
floridafifthwheeldealer.com Fifth Wheel Dealer - , Forest River RVs, RV Sales, The Original RVWholesalers, floridafifthwheeldealer.com
Fifth Wheel Dealer, , Forest River RVs, RV Wholesalers offers RVs for sale, travel trailers, toy haulers, RV parts, RV accessories, used RV sales & fifth wheel campers at the best prices. International Forest River RVs with excellent customer service. 1-877-877-4494.
Floridafifthwheeldealer.com  ~   Site Info   Whois   Trace Route   RBL Check  
pennsylvaniafifthwheeldealer.com Fifth Wheel Dealers - , CrossRoads RVs, RV Sales, The Original RVWholesalers, pennsylvaniafifthwheelrvdealer.com
Fifth Wheel Dealers, , CrossRoads RVs, RV Wholesalers offers RVs for sale, travel trailers, toy haulers, RV parts, RV accessories, used RV sales & fifth wheel campers at the best prices. International CrossRoads RVs with excellent customer service. 1-877-877-4494.
Pennsylvaniafifthwheeldealer.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: pennsylvaniafifthwheelrvdealer.com
tn5thwheelrvdealer.com Fifth Wheel Dealers - , CrossRoads RVs, RV Sales, The Original RVWholesalers, tn5thwheelrvdealer.com
Fifth Wheel Dealers, , CrossRoads RVs, RV Wholesalers offers RVs for sale, travel trailers, toy haulers, RV parts, RV accessories, used RV sales & fifth wheel campers at the best prices. International CrossRoads RVs with excellent customer service. 1-877-877-4494.
Tn5thwheelrvdealer.com  ~   Site Info   Whois   Trace Route   RBL Check  
wphaministries.org WPHA Ministries
WPHA = We Praise Him Always. Christian Radio proposal for Fairfield County, CT.
Wphaministries.org  ~   Site Info   Whois   Trace Route   RBL Check  
rkjtechnologies.com Automatic Air Inflator,Wheel Align Machines,Wheel Balancer Machine Manufacturers,India
Automatic Air Inflator manufacturers - R K J Technologies suppliers of Wheel Align Machines, Automatic Air Inflator manufacturing, indian Wheel Balancer Machine manufacturer, wholesale Automatic Air Inflator suppliers, Wheel Align Machines from india, Automatic Air Inflator, Wheel Align Machines, Wheel Balancer Machine
Rkjtechnologies.com  ~   Site Info   Whois   Trace Route   RBL Check  
colorado5thwheeldealer.com Colorado 5th Wheel Dealer - , CrossRoads RV RVs, RV Sales, The Original RVWholesalers, colorado5thwheeldealer.com
Colorado 5th Wheel Dealer, , CrossRoads RV RVs, RV Wholesalers offers RVs for sale, travel trailers, toy haulers, RV parts, RV accessories, used RV sales & fifth wheel campers at the best prices. International CrossRoads RV RVs with excellent customer service. 1-877-877-4494.
Colorado5thwheeldealer.com  ~   Site Info   Whois   Trace Route   RBL Check  
colorado5thwheelrvdealer.com Colorado 5th Wheel RV Dealer - , CrossRoads RV RVs, RV Sales, The Original RVWholesalers, colorado5thwheelrvdealer.com
Colorado 5th Wheel RV Dealer, , CrossRoads RV RVs, RV Wholesalers offers RVs for sale, travel trailers, toy haulers, RV parts, RV accessories, used RV sales & fifth wheel campers at the best prices. International CrossRoads RV RVs with excellent customer service. 1-877-877-4494.
Colorado5thwheelrvdealer.com  ~   Site Info   Whois   Trace Route   RBL Check  
missouri5thwheelrvdealer.com Fifth Wheel RV Dealers - , CrossRoads RVs, RV Sales, The Original RVWholesalers, missouri5thwheelrvdealer.com
Fifth Wheel RV Dealers, , CrossRoads RVs, RV Wholesalers offers RVs for sale, travel trailers, toy haulers, RV parts, RV accessories, used RV sales & fifth wheel campers at the best prices. International CrossRoads RVs with excellent customer service. 1-877-877-4494.
Missouri5thwheelrvdealer.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 87/588« Previous8586878889Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com