williams - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Williams: 92,459 results found.

estherjwilliams.com Esther J. Williams Fine Art
Esther J. Williams Fine Art
Estherjwilliams.com  ~   Site Info   Whois   Trace Route   RBL Check  
tjwilliamsbodyshop.com Wheel Alignment Mitchell, IN - T. J. Williams Body Shop
T. J. Williams Body Shop offers frame repair, front end alignment, computerized paint mixing and other services in Mitchell, IN. Call 888-552-0416 now.
Tjwilliamsbodyshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
williamsart.com David Williams Fine Art
David Williams Fine Art
Williamsart.com  ~   Site Info   Whois   Trace Route   RBL Check  
williamsservices.net Lawn & Grounds Maintenance New Carlisle, OH - Williams Services
Williams Services provides Lawn & Grounds Maintenance,Snow removal - salting to New Carlisle, OH and surrounding areas. Call 937-845-3025 for a free estimate.
Williamsservices.net  ~   Site Info   Whois   Trace Route   RBL Check  
workdance.com Garry Williams Art & Airbrush
Portal to Garry Williams' studio or custom paint sites
Workdance.com  ~   Site Info   Whois   Trace Route   RBL Check  
1badpixl.com Jeff Williams Photo
Jeff Williams Photo - Advertising, portraiture, landscape photography.
1badpixl.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: jeffwilliamsphoto.com
anandahimalaya.com Himalayan Healing
Learn Reiki in Nepal! Healing and nurturing in the foothills of the Himalayas.
Anandahimalaya.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: himalayanhealing.com
kevinwilliamslandscapedesign.com Lawn Cape Girardeau, MO - Williams Landscape Design 573-587-1714
Williams Landscape Design provides Commercial and residential, Landscape installation, Landscape maintenance to Cape Girardeau, MO. Call 573-587-1714
Kevinwilliamslandscapedesign.com  ~   Site Info   Whois   Trace Route   RBL Check  
kw280.com Keller Williams 280 | Birmingham, Alabama
Keller Williams 280 located in Birmingham Alabama is a Real Estate agency serving the greater Birmingham area.
Kw280.com  ~   Site Info   Whois   Trace Route   RBL Check  
dawilliams-trucks.com Truck San Jacinto, CA ( California ) - D A Williams Trucks
D A Williams Trucks is your moving resource and trucks service provider in San Jacinto, CA. Financing available. Call 951-658-0624.
Dawilliams-trucks.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 136/651« Previous134135136137138Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com