zealand - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Zealand: 83,869 results found.

gostay.com.au GoStay Accommodation Search - Find Hotels, Motels And Apartments Within Australia. GoStay Accommodation Search - Find Hotels, Motels And Apartments Within Australia.
gostay new zealand change nsw search qld icon australia vic accommodation hotels motels apartments bigpond tas white car trading pages yellow post whereis showroom citysearch sensis sites links channels using google web beach island bay great rates round cancellations site
Gostay.com.au  ~   Site Info   Whois   Trace Route   RBL Check  
emirates.co.nz Emirates New Zealand
emirates new zealand booking check dubai destinations number reference depart learn flying com skywards stopovers offers rewards flight hotels cars mobile online business policy travel pick infants return welcome drop codes best book price enabled usd european night planning promotional
Emirates.co.nz  ~   Site Info   Whois   Trace Route   RBL Check  
goldensandsmigration.com Immigration Law & Employment Specialists | Living New Zealand
goldensandsmigration new zealand immigration employment law specialists living business job visa contact button livenz home employers licensing events adviser search updates global partners footprints seminars news special team relocate relocation services migrants set settle invest licensed eligibility click iaa assessment
Goldensandsmigration.com  ~   Site Info   Whois   Trace Route   RBL Check  
localmoa.co.nz Home - Loaded Web New Zealand
localmoa new directory zealand web loaded blogs local home add blog twitter business loadedweb american canadian united kingdom australian england tauranga levin oamaru masterton hutt porirua paraparaumu pukekohe geopants site statistics contact help privacy policy com upper palmerston wellington nelson
Localmoa.co.nz  ~   Site Info   Whois   Trace Route   RBL Check  
newzealandcottage.com Coopers Beach Cottage in New Zealand, cottage accommodation, holiday rental accommodation Coopers Beach, Northland, New Zealand
New Zealand Vacation Rental, romantic getaway, beach front, weekend retreat, brand new, Cooper’s Beach, perfect honeymoon house, New Zealand cottage accommodation, cottages to stay at in New Zealand, country cottages, New Zealand holidays, New Zealand vacation, New Zealand cottages, New Zealand Holiday Letting, town houses, beach houses, New Zealand holiday homes, holiday accommodation to let, New Zealand accommodation, cottages in New Zealand, New Zealand bed and breakfasts, Zealand, New Zealand vacation
Newzealandcottage.com  ~   Site Info   Whois   Trace Route   RBL Check  
walknewzealand.com New Zealand Guided Walks
walknewzealand track new zealand guided walks tracks charlotte milford queen whirinaki routeburn abel tasman hollyford island stewart greenstone pure page map main walk day unique expert guides accommodation bathroom bedding facilities comfortable carry excellent items personal meals delicious area animals
Walknewzealand.com  ~   Site Info   Whois   Trace Route   RBL Check  
wow-newzealand.com New Zealand, wowcities.com
sign newzealand help new close popup zealand wowcities com wow page portal loading group add cities settings categoryedit layoutedit description groupedit widget tab categorydelete icondelete album organize privilegesadd pages connect albummanage keyworddelete time baloon hover simplifiedchinese traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish network balloon afrikaansalbanianarabicbelarusianbulgariancatalanchinese
Wow-newzealand.com  ~   Site Info   Whois   Trace Route   RBL Check  
airnewzealandpromotion.com Air New Zealand
airnewzealandpromotion soon coming promotion new zealand air
Airnewzealandpromotion.com  ~   Site Info   Whois   Trace Route   RBL Check  
alliance.org.nz Alliance Party of New Zealand
alliance org party new zealand follow topics platform flickr youtube twitter facebook pagelines campaign reading continue tax support government workers national economic election what labour earthquake health jobs christchurch rarr taxation rights education water view its gst hillside bombing meetings
Alliance.org.nz  ~   Site Info   Whois   Trace Route   RBL Check  
athenanewzealand.com Athena New Zealand
athenanewzealand new athena zealand adonia organics® skin info organic collection™ bronzing home shopping cart minutelift faq fans press celebrity tanning sunless stemulift greek day supply moisturizer facial appearance daily healthy cleanser complexion sun renewal serum fine youthful oils lines use
Athenanewzealand.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 504/644« Previous502503504505506Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com